Analyze Diet
European journal of biochemistry1998; 255(2); 432-438; doi: 10.1046/j.1432-1327.1998.2550432.x

Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.

Abstract: Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in this presumed invariant region. In contrast with known mammalian gastrins, which are all significantly Tyr-sulphated, the equine antral gastrins are virtually non-sulphated. Transfection of the equine preprogastrin cDNA into an endocrine cell line resulted in highly sulphated gastrins, indicating that the absence of in situ sulphation is not due to the structure of gastrin, but occurs rather because the equine antral G-cells are unique with respect to tyrosyl sulfotransferase activity. Furthermore, the marginal sulphation may explain the high proportion of gastrin-34 versus gastrin-17 in the equine antrum, since tyrosyl sulphation has been shown to promote the endoproteolytic processing of prohormones.
Publication Date: 1998-08-26 PubMed ID: 9716385DOI: 10.1046/j.1432-1327.1998.2550432.xGoogle Scholar: Lookup
The Equine Research Bank provides access to a large database of publicly available scientific literature. Inclusion in the Research Bank does not imply endorsement of study methods or findings by Mad Barn.
  • Journal Article
  • Research Support
  • Non-U.S. Gov't

Summary

This research summary has been generated with artificial intelligence and may contain errors and omissions. Refer to the original study to confirm details provided. Submit correction.

This research investigates the unique processing of progastrin, a hormone precursor, in the G-cells of horses, suggesting a minimal activity of the enzyme tyrosyl sulfotransferase. The researchers cloned a progastrin gene and found notable differences compared to other species, with the equine gastrin having a substitution of an amino acid in a key region and less sulphation. Further studies showed that this reduced sulphation wasn’t due to the structure of gastrin, but a characteristic of the horse’s antral G-cells.

Research Methodology

  • The researchers conducted a comparative study to understand the differences in progastrin processing between horses and other mammal species. They discovered a high degree of conservation in terms of gastrin, the hormone produced from progastrin, but found a significant substitution of an amino acid (Lysine for Glutamate) in a region which was previously assumed to be unchangeable across species.

Progastrin Sulphation Findings

  • In other mammals, gastrin is significantly Tyrosine-sulphated, a process which helps increase its biological functionality. However, in horses, antral gastrins (gastrins produced in the upper part of the stomach) were found to be nearly unsulphated.
  • The team transfected the equine preprogastrin cDNA into an endocrine cell line, leading to the production of highly sulphated gastrins. This showed that the lack of in situ (on-site) sulphation in horse gastrins is not due to the structure of the hormone, contradicting the initial assumption.

Evidence of Unique Tyrosyl Sulfotransferase Activity

  • The results suggest that the horse’s antral G-cells, which produce gastrin, have unique tyrosyl sulfotransferase activity. Tyrosyl sulfotransferase is the enzyme that facilitates the sulphation process.
  • This identified minimal activity of tyrosyl sulfotransferase in equine G-cells explains the high proportion of a type of gastrin, known as gastrin-34, compared to another type, known as gastrin-17, in the horse’s antrum (part of the stomach). This suggests that tyrosyl sulphation promotes the endoproteolytic processing of prohormones, in which large precursor molecules are cut into smaller, active hormones.

Cite This Article

APA
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF. (1998). Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity. Eur J Biochem, 255(2), 432-438. https://doi.org/10.1046/j.1432-1327.1998.2550432.x

Publication

ISSN: 0014-2956
NlmUniqueID: 0107600
Country: England
Language: English
Volume: 255
Issue: 2
Pages: 432-438

Researcher Affiliations

Johnsen, A H
  • Department of Clinical Biochemistry, Rigshospitalet, The National University Hospital, Copenhagen, Denmark. johnsen@rh.dk
Sandin, A
    Rourke, I J
      Bundgaard, J R
        Nilsson, G
          Rehfeld, J F

            MeSH Terms

            • Amino Acid Sequence
            • Animals
            • Base Sequence
            • Cattle
            • Enterochromaffin Cells / enzymology
            • Gastric Mucosa / cytology
            • Gastric Mucosa / enzymology
            • Gastrins / biosynthesis
            • Gastrins / chemistry
            • Gastrins / genetics
            • Gastrins / metabolism
            • Horses
            • Humans
            • Mass Spectrometry
            • Molecular Sequence Data
            • Polymerase Chain Reaction
            • Protein Precursors / chemistry
            • Protein Precursors / genetics
            • Protein Precursors / metabolism
            • Protein Processing, Post-Translational
            • Pyloric Antrum
            • Sequence Alignment
            • Sequence Homology, Amino Acid
            • Sulfotransferases / metabolism
            • Swine

            Citations

            This article has been cited 1 times.
            1. Guerrero JLS, Brito PHS, Ferreira MA, Arantes JA, Rusch E, Oliveira BVDS, Velasco-Bolaños J, Carregaro AB, Dória RGS. Evaluation of Gastric pH and Gastrin Concentrations in Horses Subjected to General Inhalation Anesthesia in Dorsal Recumbency. Animals (Basel) 2024 Apr 15;14(8).
              doi: 10.3390/ani14081183pubmed: 38672331google scholar: lookup