Analyze Diet

European journal of biochemistry

Discontinued
Periodical
Biochemistry
Publisher:
Springer.. Oxford, UK : Blackwell Science Ltd. on behalf of the Federation of European Biochemical Societies (2004)
Frequency: Twenty four no. a year
Country: England
Language: English
Author(s):
Federation of European Biochemical Societies.
Start Year:1967 - 2004
ISSN:
0014-2956 (Print)
1432-1033 (Electronic)
0014-2956 (Linking)
Impact Factor
5.622
2021
NLM ID:0107600
(DNLM):E15940000(s)
(OCoLC):01568454
Coden:EJBCAI
Classification:W1 EU68
Thermal unfolding of monomeric and dimeric beta-lactoglobulins.
European journal of biochemistry    October 19, 2001   Volume 268, Issue 20 5439-5448 doi: 10.1046/j.0014-2956.2001.02484.x
Fessas D, Iametti S, Schiraldi A, Bonomi F.The thermal stabilities of dimeric bovine beta-lactoglobulin and monomeric equine beta-lactoglobulin were investigated at neutral pH by means of differential scanning calorimetry, circular dichroism, tryptophan fluorescence, and by binding of an hydrophobic probe. Differential scanning calorimetry showed the presence of two structural domains with different thermal stabilities in both proteins. Thermodynamic analysis of the calorimetric signal revealed that the two domains unfold independently according to a mechanism where an equilibrium step is followed by an irreversible transition. The spe...
Cytochrome c reconstituted from two peptide fragments displays native-like redox properties.
European journal of biochemistry    August 15, 2001   Volume 268, Issue 16 4537-4543 doi: 10.1046/j.1432-1327.2001.02373.x
Sinibaldi F, Fiorucci L, Mei G, Ferri T, Desideri A, Ascoli F, Santucci R.Recombination of two fragments of horse cytochrome c (the heme-containing N-fragment, residues 1-56, and the C-fragment, residues 57-104), which are substantially unstructured at neutral pH, gives rise to a 1:1 fragment complex with a compact conformation, in which the alpha helical structure and the native Met80-Fe(III) axial bond are recovered. With respect to the native protein, the ferric complex shows a less rigid atomic packing and a decreased stability [Delta(DeltaG(o))D = 14.7 kJ.mol(-1)], ascribed to perturbations involving the Trp59 microenvironment and, to a lower extent, the heme p...
Functional and computer modelling studies of haemoglobin from horse. The haemoglobin system of the Sardinian wild dwarf horse.
European journal of biochemistry    June 8, 2001   Volume 268, Issue 11 3313-3320 doi: 10.1046/j.1432-1327.2001.02235.x
Pellegrini M, Corda M, Manca L, Olianas A, Sanna MT, Fais A, De Rosa MC, Bertonati C, Masala B, Giardina B.A study was made of the haemoglobin (Hb) system from the Sardinian dwarf horse (Equus caballus jara), one of the last surviving wild horse species in Europe. The oxygen binding properties of the whole haemolysate and of the four different horse Hbs, separated by ion-exchange chromatography, were studied with special regard to the effect of chloride, 2,3-diphosphoglycerate and lactate. Results indicate that no significant functional differences exist between the four Hb components of horse haemolysate. Moreover, the molecular basis of the intrinsically low oxygen affinity and of the weak intera...
Biochemical characterization and surfactant properties of horse allergens.
European journal of biochemistry    May 19, 2001   Volume 268, Issue 10 3126-3136 doi: 10.1046/j.1432-1327.2001.02217.x
Goubran Botros H, Poncet P, Rabillon J, Fontaine T, Laval JM, David B.A new allergen from horse dander, Equ c 5 has been purified. Its biochemical and biophysical properties have been characterized and compared with those of Equ c 1, Equ c 2 and Equ c 4. Their molecular masses, determined by mass spectrometry, were 22 kDa for Equ c 1, 16 kDa for Equ c 2, 18.7 kDa for Equ c 4 and 16.7 kDa for Equ c 5. Their pI values were between 3.8 and 5.25. Equ c 2 and Equ c 5 are not glycosylated, while Equ c 4 contains a tri-antennary tri-sialylated N-linked glycan. Linkages of terminal N-acetylneuraminic acid to galactose were: alpha-(2-->6) in Equ c 4, and both alpha-(2...
Monitoring the conformational flexibility of cytochrome c at low ionic strength by 1H-NMR spectroscopy.
European journal of biochemistry    October 6, 1998   Volume 256, Issue 2 271-278 doi: 10.1046/j.1432-1327.1998.2560271.x
Banci L, Bertini I, Reddig T, Turano P.Horse heart cytochrome c at pH 7 and low ionic strength is present as two conformers, as evidenced by 1H-NMR spectroscopy. The two structures have been calculated using NOE and pseudocontact shift constraints. They have the same folding patterns and are essentially equal, within the rmsd of the families. The two average structures have rmsd values of 0.049 nm and 0.093 nm for the backbone and the heavy atoms, respectively. Such a difference has been analyzed through a detailed analysis of the NOEs. It appears that the species at low ionic strength differs from the species present at high ionic...
Carboxymethylated phosphatidylethanolamine in mitochondrial membranes of mammals–evidence for intracellular lipid glycoxidation.
European journal of biochemistry    September 17, 1998   Volume 255, Issue 3 685-689 doi: 10.1046/j.1432-1327.1998.2550685.x
Pamplona R, Requena JR, Portero-Otín M, Prat J, Thorpe SR, Bellmunt MJ.The non-enzymatic modification of aminophospholipids with lipoperoxidation-derived aldehydes and glycoxidation-derived products have been reported previously. However, it remains unknown whether intracellular membranes are damaged by these glycoxidation-derived products. To investigate this issue, we tested whether aminophospholipids from mitochondrial membranes are damaged by glycoxidative stress the mitochondrion being identified as the major site of reactive-species production in the cell. We have used a selected-ion-monitoring/gas-chromatography/mass-spectrometry assay for carboxymethyleth...
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
Characterization of a O-fatty-acylated sulfatide from equine brain.
European journal of biochemistry    August 6, 1998   Volume 255, Issue 1 289-295 doi: 10.1046/j.1432-1327.1998.2550289.x
Mikami T, Tsuchihashi K, Kashiwagi M, Yachida Y, Daino T, Hashi K, Akino T, Gasa S.A sulfatide, O-fatty-acylated 3-sulfogalactosylceramide at C6-O on galactoside, was isolated from equine brain and the chemical structure was characterized by proton NMR and MS. The O-acylation site of the acylated sulfatide was determined by the down-field shift of protons attached to a carbon having an O-acyl group in the NMR spectrum and by analysis of a partially methylated derivative before and after acetalization of the intact sulfatide using GC-MS. The O-acyl chain length was determined by GLC, revealing that it exclusively had palmitoyl and stearoyl residues as the major fatty acids. T...
Equus caballus gelsolin–cDNA sequence and protein structural implications.
European journal of biochemistry    March 7, 1998   Volume 251, Issue 3 613-621 doi: 10.1046/j.1432-1327.1998.2510613.x
Koepf EK, Hewitt J, Vo H, Macgillivray RT, Burtnick LD.We have generated and characterized the cDNA from equine smooth muscle that encodes gelsolin, an actin-modulating protein. Overlapping cDNA clones synthesized by the reverse transcriptase/polymerase chain reaction and clones isolated from a horse genomic library provided the complete primary structure for the intracellular isoform of gelsolin, while cDNA complemented with protein sequence data produced the full-length primary transcript of the gelsolin isoform found circulating in equine plasma. The deduced amino acid sequences of the intracellular and secreted versions of equine gelsolin infe...
Fourier-transform infrared spectroscopic studies on the coordination of the side-chain COO- groups to Ca2+ in equine lysozyme.
European journal of biochemistry    February 7, 1998   Volume 250, Issue 1 72-76 doi: 10.1111/j.1432-1033.1997.00072.x
Mizuguchi M, Nara M, Ke Y, Kawano K, Hiraoki T, Nitta K.Interactions between Ca2+ and the Asp side chains in the Ca2+-binding site of equine lysozyme were investigated by Fourier-transform infrared (FT-IR) spectroscopy. In the spectrum of equine lysozyme, the intensities of the bands at about 1595 cm-1 and 1578 cm-1 in the region of the COO antisymmetric stretches increased upon Ca2+ binding. In the region of the COO- symmetric stretches, the loss of intensity at about 1388 cm-1 and gains of intensities at about 1423 cm-1 and 1403 cm-1 were observed due to Ca2+ binding to equine lysozyme. The spectral changes for equine lysozyme indicate that the C...
1H-NMR study of inter-segmental hydrogen bonds in sperm whale and horse apomyoglobins.
European journal of biochemistry    January 15, 1997   Volume 243, Issue 1-2 292-298 doi: 10.1111/j.1432-1033.1997.0292a.x
Yamamoto Y.NMR signals for HisB5 N(delta)H and HisEF5 N(epsilon)H protons of sperm whale and horse apomyoglobins were assigned and compared with the corresponding signals of the holoproteins in terms of pH and temperature dependence behaviors of their shifts and line widths in order to gain insight into structural difference between the apoproteins and the holoproteins. Since these protons are involved in internal hydrogen bonds at the interfaces between the B helix and the GH corner and between the EF corner and the H helix, local structures of the interfaces in these proteins have been inferred from th...
Primary structure of stallion seminal plasma protein HSP-7, a zona-pellucida-binding protein of the spermadhesin family.
European journal of biochemistry    December 15, 1996   Volume 242, Issue 3 636-640 doi: 10.1111/j.1432-1033.1996.0636r.x
Reinert M, Calvete JJ, Sanz L, Mann K, Töpfer-Petersen E.The primary-structure of HSP-7, a 14-kDa protein isolated from stallion seminal plasma, has been determined, HSP-7 belongs to the spermadhesin protein family, shares 98% sequence identity with the boar seminal plasma protein AWN, and, like its boar homolog, displays zona-pellucida-binding activity. Despite these conserved structural and functional features, the equine and porcine spermadhesins differ in their topography on spermatozoa.
The structure of the keratan sulphate chains attached to fibromodulin isolated from articular cartilage.
European journal of biochemistry    December 1, 1996   Volume 242, Issue 2 402-409 doi: 10.1111/j.1432-1033.1996.0402r.x
Lauder RM, Huckerby TN, Nieduszynski IA.Fibromodulin has been isolated from bovine and equine articular cartilage and the attached keratan sulphate chains subjected to digestion by keratanase II. The oligosaccharides generated have been reduced and subsequently isolated by strong anion-exchange chromatography. Their structures have been determined by high-field 1H-NMR spectroscopy and high-pH anion-exchange chromatography. Both alpha(2-6)- and alpha(2-3)-linked N-acetylneuraminic acid have been found in the capping oligosaccharides, and, fucose which is alpha(1-3)-linked to N-acetylglucosamine has been found as a branch in both repe...
Equilibrium unfolding studies of horse muscle acylphosphatase.
European journal of biochemistry    November 1, 1994   Volume 225, Issue 3 811-817 doi: 10.1111/j.1432-1033.1994.0811b.x
Taddei N, Buck M, Broadhurst RW, Stefani M, Ramponi G, Dobson CM.The stability and equilibrium unfolding behaviour of horse muscle acylphosphatase have been studied by denaturing the protein under various conditions of temperature, pH, and urea concentration. Far-ultraviolet circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopy indicate that this small monomeric protein unfolds reversibly and cooperatively. Thermodynamic parameters, the Gibbs free energy delta G and enthalpy delta H of unfolding, have been estimated for denaturation of the protein from NMR and CD data as 19 kJ mol-1 and 350 kJ mol-1, respectively. CD and 1H-NMR results s...
Further characterisation of forms of haemosiderin in iron-overloaded tissues.
European journal of biochemistry    October 1, 1994   Volume 225, Issue 1 187-194 doi: 10.1111/j.1432-1033.1994.00187.x
Ward RJ, Ramsey M, Dickson DP, Hunt C, Douglas T, Mann S, Aquad F, Peters TJ, Crichton RR.The biochemical and biophysical properties of isolated haemosiderins have been compared to that of another iron-containing protein, termed prehaemosiderin, which sediments through chaotropic potassium iodide only after 20 h of ultracentrifugation, in contrast to that of haemosiderin which is recovered after 2 h of ultracentrifugation. The iron/protein ratio and iron/phosphate ratio were less that that of the corresponding haemosiderin, while the elemental composition was also reduced in many of the prehaemosiderin samples. Mossbauer spectroscopy and electron diffraction identified the predomin...
P2 protamines are phosphorylated in vitro by protein kinase C, whereas P1 protamines prefer cAMP-dependent protein kinase. A comparative study of five mammalian species.
European journal of biochemistry    July 1, 1994   Volume 223, Issue 1 165-169 doi: 10.1111/j.1432-1033.1994.tb18979.x
Pirhonen A, Linnala-Kankkunen A, Mënpää PH.P1 protamines isolated from ejaculated human, stallion, bull, boar and ram spermatozoa and P2 protamines from human and stallion spermatozoa were subjected, after alkaline phosphatase treatment, to in vitro phosphorylation reactions using cAMP-dependent protein kinase (PKA) and protein kinase C (PKC). All P1 protamines were phosphorylated by PKA, whereas P2 protamines were phosphorylated only by PKC. In addition, human, stallion and boar, but not bull and ram, P1 protamines were phosphorylated by PKC. After phosphoamino acid analysis, the protamines showing positive signals for phosphoserine (...
Expression cloning of an equine T-lymphocyte glycoprotein CD2 cDNA. Structure-based analysis of conserved sequence elements.
European journal of biochemistry    February 1, 1994   Volume 219, Issue 3 969-976 doi: 10.1111/j.1432-1033.1994.tb18579.x
Tavernor AS, Kydd JH, Bodian DL, Jones EY, Stuart DI, Davis SJ, Butcher GW.An equine CD2 cDNA has been isolated by monoclonal antibody screening of a T-lymphocyte cDNA library. The cDNA contained an open reading frame of 1041 bp encoding a translated product of 347 amino acids. Northern blotting analysis revealed a single mRNA species expressed in spleen, thymus and activated peripheral lymphocytes. The predicted amino acid sequence has 50-65% identity with the human, rat and mouse CD2 sequences with greatest similarity shared with the human homologue. Evolutionarily conserved structural and functional domains in CD2 were identified by comparing the sequences of the ...
X-ray and primary structure of horse serum albumin (Equus caballus) at 0.27-nm resolution.
European journal of biochemistry    July 1, 1993   Volume 215, Issue 1 205-212 doi: 10.1111/j.1432-1033.1993.tb18024.x
Ho JX, Holowachuk EW, Norton EJ, Twigg PD, Carter DC.The amino-acid sequence and three-dimensional structure of equine serum albumin have been determined. The amino-acid sequence was deduced from cDNA isolated from equine liver. Comparisons of the primary structure of equine serum albumin with human serum albumin and bovine serum albumin reveal 76.1% and 73.9% sequence identity, respectively. The three-dimensional structure was determined crystallographically by the molecular-replacement method using molecular coordinates from the previously determined structure of human serum albumin, to a resolution of 0.27 nm. In accordance with the primary s...
Different in vitro metabolism of 7 alpha-methyl-19-nortestosterone by human and equine aromatases.
European journal of biochemistry    June 1, 1993   Volume 214, Issue 2 569-576 doi: 10.1111/j.1432-1033.1993.tb17955.x
Moslemi S, Dintinger T, Dehennin L, Silberzahn P, Gaillard JL.The ability of human and equine placental microsomes to aromatize 7 alpha-methyl-19-nortestosterone (MNT) was studied. Kinetic analysis indicates that MNT shares the androgen-binding site of human and equine placental microsomal aromatases. Human placental microsomal estrogen synthetase had about a 2.5-fold higher relative affinity for MNT than the equine placental enzyme (KiMNT/Km androstenedione of 32 versus 87). However, MNT was not metabolized by human placental microsomes, whereas it was very actively metabolized by equine placental microsomes. Further studies using purified equine cytoch...
Sequence of horse pancreatic lipase as determined by protein and cDNA sequencing. Implications for p-nitrophenyl acetate hydrolysis by pancreatic lipases.
European journal of biochemistry    May 15, 1992   Volume 206, Issue 1 279-287 doi: 10.1111/j.1432-1033.1992.tb16926.x
Kerfelec B, Foglizzo E, Bonicel J, Bougis PE, Chapus C.The complete sequence of the horse pancreatic lipase was elucidated by combining polypeptide chain and cDNA sequencing. Among the structural features of horse lipase, it is worth mentioning that Lys373 is not conserved. This residue, which is present in human, porcine and canine lipases, has been assumed to be involved in p-nitrophenyl acetate hydrolysis by pancreatic lipases. Kinetic investigation of the p-nitrophenyl acetate hydrolysis by the various pancreatic lipases and by the C-terminal domain (336-449) of human lipase reveals that this hydrolysis is the result of the superimposition of ...
Calcium-ionophore-induced formation of platelet-activating factor and leukotrienes by horse eosinophils: a comparative study.
European journal of biochemistry    February 14, 1990   Volume 187, Issue 3 475-480 doi: 10.1111/j.1432-1033.1990.tb15328.x
Asmis R, Jörg A.Horse eosinophils preincubated with 3H-labelled acetate and stimulated with the Ca2+ ionophores ionomycin or A23187 form a radioactive compound, which we have shown to be 1-O-alkyl-2-[3H]acetyl-sn-glycero-3-phosphocholine (platelet-activating factor). We could detect no 1-O-acyl-2-[3H]acetyl-glycero-3-phosphocholine in the radioactive fraction. The formation of platelet-activating factor was strongly correlated to the generation of leukotriene C4, the main arachidonate metabolite in horse eosinophils, suggesting that platelet-activating factor and leukotriene C4 have a common precursor pool (1...
Primary structure of horse serotransferrin glycans. Demonstration that heterogeneity is related to the number of glycans and to the presence of N-acetylneuraminic acid and N-acetyl-4-O-acetylneuraminic acid.
European journal of biochemistry    December 22, 1989   Volume 186, Issue 3 583-590 doi: 10.1111/j.1432-1033.1989.tb15248.x
Coddeville B, Stratil A, Wieruszeski JM, Strecker G, Montreuil J, Spik G.Three serotransferrin variants Tf 2a, Tf 4b and Tf 5b were isolated in an homogeneous form from a preparation of homozygous horse serotransferrin Tf 0. On the basis of the results concerning molecular mass determination and the carbohydrate analysis, it is concluded that the serotransferrin variant Tf 2a contains only one glycan while variants Tf 4b and Tf 5b contain two glycans. The structure of all of the glycans has been established by combining methylation analysis, mass spectrometry and 400-MHz 1H-NMR spectroscopy. From the obtained results, it appears that the two glycans of Tf 5b varian...
The sequence-specific assignment of the 1H-NMR spectrum of an enzyme, horse-muscle acylphosphatase.
European journal of biochemistry    June 1, 1989   Volume 182, Issue 1 85-93 doi: 10.1111/j.1432-1033.1989.tb14803.x
Saudek V, Boyd J, Williams RJ, Stefani M, Ramponi G.A complete range of two-dimensional NMR experiments was used for the assignment of the 1H-NMR spectrum of horse muscle acylphosphatase. Firstly the spin systems of some easily identifiable amino acid side chains were assigned. These side chains involved all the aromatic residues and all the leucine, valine, isoleucine, threonine, alanine, proline as well as some of the glycine residues. Analysis of nuclear Overhauser enhancement spectra in our previous work had identified the sequential and long-range patterns characteristics for secondary structure elements. This result had also provided the ...
Analysis of N-acetyl-4-O-acetylneuraminic-acid-containing N-linked carbohydrate chains released by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase F. Application to the structure determination of the carbohydrate chains of equine fibrinogen.
European journal of biochemistry    March 1, 1989   Volume 180, Issue 1 101-110 doi: 10.1111/j.1432-1033.1989.tb14620.x
Damm JB, Voshol H, Hård K, Kamerling JP, Vliegenthart JF.The carbohydrate chains of equine fibrinogen were enzymatically released by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase F. The oligosaccharides obtained were fractionated by a combination of FPLC and HPLC and analyzed by 500-MHz 1H-NMR spectroscopy. Four monosialo and four disialo diantennary N-acetyllactosamine type of carbohydrate chains occur: (formula; see text)
Monoclonal antibody recognizes a conformational epitope in a random coil protein.
European journal of biochemistry    December 1, 1988   Volume 178, Issue 1 219-224 doi: 10.1111/j.1432-1033.1988.tb14446.x
Saad B, Corradin G, Bosshard HR.The antigenic determinants for two monoclonal antibodies directed against horse apo-cytochrome c, a protein of disordered structure, as judged by spectroscopic and hydrodynamic criteria, have been studied by a combination of methods: antigen competition in solution by radio immunoassay and enzyme-linked immunoassay, and differential acetylation of free and antibody-bound antigen. In the latter method the accessibility of lysine residues of the antigen in the antigen-antibody complex is compared to the accessibility in the free antigen. The two antibodies against the heme-free protein do not re...
Molecular mechanics calculation of geometries of NAD+ derivatives, modified in the nicotinamide group, in a ternary complex with horse liver alcohol dehydrogenase.
European journal of biochemistry    August 15, 1988   Volume 175, Issue 3 581-585 doi: 10.1111/j.1432-1033.1988.tb14231.x
de Kok PM, Beijer NA, Buck HM, Sluyterman LA, Meijer EM.The geometry of seven NAD+ analogues bound to horse liver alcohol dehydrogenase (LADH) modified only in their nicotinamide group, have been studied using AMBER molecular mechanics energy-minimization procedures. Starting geometries were taken from X-ray crystallographic data for NAD+/Me2SO/LADH reported by Eklund and co-workers. In this study the NAD+ analogues were encaged by the constituent amino acids of the enzyme within a range of 0.6 nm from the initial NAD+/Me2SO/Zn2+ complex. The calculational method used is able to rationalize individual substituent effects and to evaluate the essenti...
Mitochondrial aldehyde dehydrogenase from horse liver. Correlations of the same species variants for both the cytosolic and the mitochondrial forms of an enzyme.
European journal of biochemistry    March 15, 1988   Volume 172, Issue 3 527-533 doi: 10.1111/j.1432-1033.1988.tb13920.x
Johansson J, von Bahr-Lindström H, Jeck R, Woenckhaus C, Jörnvall H.The primary structure of the mitochondrial form of horse liver aldehyde dehydrogenase has been determined, utilizing peptide analyses and homology with other enzyme forms. The subunit exhibits N-terminal heterogeneity in size similar to that for the corresponding human mitochondrial protein, the longest form having 500 residues. Catalase was identified as a contaminant of the preparations. All four pairs within a set of aldehyde dehydrogenases can now be compared, including the same two species variants (horse and human) for both the cytosolic and mitochondrial enzyme, revealing characteristic...
Iodide-induced inhibition of adenylate cyclase activity in horse and dog thyroid.
European journal of biochemistry    December 30, 1987   Volume 170, Issue 1-2 435-442 doi: 10.1111/j.1432-1033.1987.tb13718.x
Cochaux P, Van Sande J, Swillens S, Dumont JE.The characteristics of the iodide-induced inhibition of cyclic AMP accumulation in dog thyroid slices have been previously described [Van Sande, J., Cochaux, P. and Dumont, J. E. (1985) Mol. Cell. Endocrinol. 40, 181-192]. In the present study we investigated the characteristics of the iodide-induced inhibition of adenylate cyclase activity in dog and horse thyroid. The inhibition of cyclic AMP accumulation by iodide in stimulated horse thyroid slices was similar to that observed in dog thyroid slices. The inhibition was observed in slices stimulated by thyroid-stimulating hormone, cholera tox...
Enzymatic trimethylation of lysine-72 in cytochrome c.
European journal of biochemistry    September 15, 1983   Volume 135, Issue 2 259-262 doi: 10.1111/j.1432-1033.1983.tb07646.x
Paik WK, Farooqui J, Gupta A, Smith HT, Millett F.The present observations are the continuation of our earlier study on the physicochemical mechanism of protein-lysine methylation. In this paper the electrophoretic behaviour (pI values) of two chemically modified horse heart cytochromes c at lysine-72 with trifluoromethylphenylcarbamoyl (neutral group) or carboxydinitrophenyl (acidic group) is compared with the enzymatically methylated cytochrome c. The results indicate that although both chemically modified cytochromes c have lower pI values than the unmodified cytochrome c, the enzymatic methylation appears to be much more efficient in lowe...
Pancreatic colipase: crystallographic and biochemical aspects.
European journal of biochemistry    April 1, 1982   Volume 123, Issue 2 347-354 doi: 10.1111/j.1432-1033.1982.tb19774.x
Pierrot M, Astier JP, Astier M, Charles M, Drenth J.A detailed study of the crystallization of hog and horse colipases has been undertaken. Several crystallographic varieties have been obtained and a 0.3-nm resolution structure determination is actually in progress. The sequence of the A form of horse colipase (one methionine) is given. From spectrophotometric experiments and sequence comparisons, the involvement of the aromatic residue in position 52 in the micelle binding site has been demonstrated.