Analyze Diet

Topic:Peptides

Peptides are short chains of amino acids that are involved in various biological processes in horses. They function as signaling molecules, influencing physiological activities such as metabolism, immune response, and tissue repair. Peptides can be naturally occurring or synthetically derived, and they may serve as therapeutic agents in veterinary medicine. In equine health, peptides are studied for their potential applications in enhancing performance, supporting recovery, and managing conditions like osteoarthritis. This page compiles peer-reviewed research studies and scholarly articles that explore the structure, function, and potential applications of peptides in the context of equine health and disease management.
Amino acid modifications in canine, equine and porcine pituitary growth hormones, identified by peptide-mass mapping.
Journal of chromatography. B, Biomedical sciences and applications    June 22, 2001   Volume 757, Issue 2 237-245 doi: 10.1016/s0378-4347(01)00154-2
Secchi C, Berrini A, Gaggioli D, Borromeo V.Modified amino acid residues in porcine, canine and equine growth hormones purified from pituitary glands were characterised by tryptic mapping and high-performance liquid chromatography with on-line coupled electrospray ionisation mass spectrometry (HPLC-ESI-MS) detection. Hormones from all three species showed the same changes. Conversion of Asp128 to iso-Asp128 was a component of native hormones, while deamidation of Asn12 and Asn98 to Asp and iso-Asp, oxidation of Met4, and cyclisation to the pyroglutamyl derivative of Gln139, probably occurred in vitro, during isolation, storage or hydrol...
Biochemical characterization and surfactant properties of horse allergens.
European journal of biochemistry    May 19, 2001   Volume 268, Issue 10 3126-3136 doi: 10.1046/j.1432-1327.2001.02217.x
Goubran Botros H, Poncet P, Rabillon J, Fontaine T, Laval JM, David B.A new allergen from horse dander, Equ c 5 has been purified. Its biochemical and biophysical properties have been characterized and compared with those of Equ c 1, Equ c 2 and Equ c 4. Their molecular masses, determined by mass spectrometry, were 22 kDa for Equ c 1, 16 kDa for Equ c 2, 18.7 kDa for Equ c 4 and 16.7 kDa for Equ c 5. Their pI values were between 3.8 and 5.25. Equ c 2 and Equ c 5 are not glycosylated, while Equ c 4 contains a tri-antennary tri-sialylated N-linked glycan. Linkages of terminal N-acetylneuraminic acid to galactose were: alpha-(2-->6) in Equ c 4, and both alpha-(2...
B-Cell epitope mapping of the VapA protein of Rhodococcus equi: implications for early detection of R. equi disease in foals.
Journal of clinical microbiology    April 3, 2001   Volume 39, Issue 4 1633-1637 doi: 10.1128/JCM.39.4.1633-1637.2001
Vanniasinkam T, Barton MD, Heuzenroeder MW.Linear B-cell epitopes of the Rhodococcus equi virulence-associated protein (VapA) were mapped using a synthetic peptide bank in this study. The peptides were screened in an enzyme-linked immunosorbent assay (ELISA) with a total of 70 sera from foals with current R. equi disease (51 sera), as well as from foals that had either recovered from R. equi infection 10 months previously (3 sera) or that had no known history of R. equi disease (16 sera). An epitope with the sequence NLQKDEPNGRA was identified and was universally recognized by all 51 sera from foals with R. equi disease and was not rec...
Design and validation of an ELISA for equine infectious anemia (EIA) diagnosis using synthetic peptides.
Veterinary microbiology    March 7, 2001   Volume 79, Issue 2 111-121 doi: 10.1016/s0378-1135(00)00352-7
Soutullo A, Verwimp V, Riveros M, Pauli R, Tonarelli G.Three peptides derived from the equine infectious anemia virus (EIAV) surface proteins were synthesized to design and validate an ELISA for EIA diagnosis. Peptides identified as gp90-I and gp90-II correspond to the N- and C-terminal part of the surface glycoprotein gp90. Peptide gp45-1 overlaps the immunodominant epitope CIERTHVFC of the transmembrane glycoprotein gp45, and includes a hydrophilic chain close to the N-terminal end of this nonapeptide loop. Serum samples from 140 naturally infected horses with EIAV and a panel of 167 non-immune equine sera obtained from non-infected animals were...
Rate of intrachain contact formation in an unfolded protein: temperature and denaturant effects.
Journal of molecular biology    February 13, 2001   Volume 305, Issue 5 1161-1171 doi: 10.1006/jmbi.2000.4366
Hagen SJ, Carswell CW, Sjolander EM.We have measured the effect of temperature and denaturant concentration on the rate of intrachain diffusion in an unfolded protein. After photodissociating a ligand from the heme iron of unfolded horse cytochrome c, we use transient optical absorption spectroscopy to measure the time scale of the diffusive motions that bring the heme, located at His18, into contact with its native ligand, Met80. Measuring the rate at which this 62 residue intrachain loop forms under both folding and unfolding conditions, we find a significant effect of denaturant on the chain dynamics. The diffusion of the cha...
Equine muscular dystrophy with myotonia.
Clinical neurophysiology : official journal of the International Federation of Clinical Neurophysiology    February 13, 2001   Volume 112, Issue 2 294-299 doi: 10.1016/s1388-2457(00)00511-3
Montagna P, Liguori R, Monari L, Strong PN, Riva R, Di Stasi V, Gandini G, Cipone M.To describe a case of equine muscular dystrophy with myotonia. Methods: A 5-year-old horse presented with hypertrophy and delayed relaxation of the muscles of the hindlimbs from age 2 months. Testicular atrophy developed from 2 years of age. Action and percussion myotonia was associated with weakness in these muscles, and EMG showed diffuse myotonic discharges and myopathic features. Biopsy of the gluteal muscle showed adipose and connective tissue infiltration, marked variation in muscle fibre size, and moth-eaten, ring and whorled fibres. Results: Injection of apamin, a peptide blocker of ca...
Heterologous expression of lacticin 3147 in Enterococcus faecalis: comparison of biological activity with cytolysin.
Letters in applied microbiology    February 13, 2001   Volume 32, Issue 2 71-77 doi: 10.1046/j.1472-765x.2001.00864.x
Ryan MP, McAuliffe O, Ross RP, Hill C.Lacticin 3147 is a broad-spectrum, two-component, lanthionine-containing bacteriocin produced by Lactococcus lactis DPC3147 which has widespread food and biomedical applications as a natural antimicrobial. Other two-component lantibiotics described to date include cytolysin and staphylococcin C55. Interestingly, cytolysin, produced by Enterococcus faecalis, has an associated haemolytic activity. The objective of this study was to compare the biological activity of lacticin 3147 with cytolysin. The lacticin 3147-encoding determinants were heterologously expressed in Ent. faecalis FA2-2, a plasm...
Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. a mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis.
International archives of allergy and immunology    December 12, 2000   Volume 123, Issue 3 220-227 doi: 10.1159/000024447
Bulone V, Rademaker GJ, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J.Separation of horse dander allergens using two-dimensional PAGE resulted in the identification of 16 proteins that react with allergic patient sera. A sensitive method has been developed for analysing the structures of the glycan chains of individual glycoprotein allergens transferred to blots following two-dimensional PAGE, and has allowed the structural identification of the glycan chains of the most abundant isoforms of Equ c 1, a glycosylated horse dander major allergen. The method involves separation of the allergens by two-dimensional PAGE, transfer to polyvinylidene difluoride membranes...
Equine infectious anaemia virus proteins with epitopes most frequently recognized by cytotoxic T lymphocytes from infected horses.
The Journal of general virology    October 20, 2000   Volume 81, Issue Pt 11 2735-2739 doi: 10.1099/0022-1317-81-11-2735
McGuire TC, Leib SR, Lonning SM, Zhang W, Byrne KM, Mealey RH.Efficacious lentiviral vaccines designed to induce cytotoxic T lymphocytes (CTL) in outbred populations with a diverse repertoire of MHC class I molecules should contain or express multiple viral proteins. To determine the equine infectious anaemia virus (EIAV) proteins with epitopes most frequently recognized by CTL from seven horses infected for 0.5 to 7 years, retroviral vector-transduced target cells expressing viral proteins were used in CTL assays. Gag p15 was recognized by CTL from 100% of these infected horses. p26 was recognized by CTL from 86%, SU and the middle third of Pol protein ...
Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate based delivery system.
Vaccine    October 12, 2000   Volume 19, Issue 4-5 492-497 doi: 10.1016/s0264-410x(00)00187-0
Nally JE, Artiushin S, Sheoran AS, Burns PJ, Simon B, Gilley RM, Gibson J, Sullivan S, Timoney JF.Streptococcus equi causes equine strangles, a highly contagious disease of the upper respiratory tract. The antiphagocytic surface protein SeM is strongly immunogenic and evokes mucosal and systemic antibodies during convalescence. The present study investigated the potential of sucrose acetate isobutyrate (SAIB); a high viscosity excipient that provides controlled release of biologically active substances, to enhance antibody responses following intranasal immunization of horses with a 108 a.a. peptide of SeM (SeMF3). SeMF3-SAIB was administered intranasally to each of the 11 adult horses on ...
Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.
Journal of virological methods    August 2, 2000   Volume 88, Issue 1 89-104 doi: 10.1016/s0166-0934(00)00183-x
Birch-Machin I, Ryder S, Taylor L, Iniguez P, Marault M, Ceglie L, Zientara S, Cruciere C, Cancellotti F, Koptopoulos G, Mumford J, Binns M....Three filamentous phage random peptide display libraries were used in biopanning experiments with purified IgG from the serum of a gnotobiotic foal infected with equine herpesvirus-1 (EHV-1) to enrich for epitopes binding to anti-EHV-1 antibodies. The sequences of the amino acids displayed were aligned with protein sequences of EHV-1, thereby identifying a number of potential antibody binding regions. Presumptive epitopes were identified within the proteins encoded by genes 7 (DNA helicase/primase complex protein), 11 (tegument protein), 16 (glycoprotein C), 41 (integral membrane protein), 70 ...
Insulin-like growth factor (IGF)-binding protein-4 proteolytic degradation in bovine, equine, and porcine preovulatory follicles: regulation by IGFs and heparin-binding domain-containing peptides.
Biology of reproduction    July 25, 2000   Volume 63, Issue 2 390-400 doi: 10.1095/biolreprod63.2.390
Mazerbourg S, Zapf J, Bar RS, Brigstock DR, Monget P.We recently showed that insulin-like growth factor-binding protein-4 (IGFBP-4) proteolytic degradation in ovine preovulatory ovarian follicles is IGF-dependent and regulated by the heparin-binding domain (HBD) from IGFBP-3 and from connective tissue growth factor (CTGF), heparan/heparin-interacting protein (HIP), and vitronectin. The present study investigated regulation of IGFBP-4 proteolytic degradation in porcine, bovine, and equine ovarian preovulatory follicles. Follicular fluid from such preovulatory follicles contains proteolytic activity, degrading exogenous IGFBP-4. An excess of IGF-I...
Development of a fluorescence polarization-based diagnostic assay for equine infectious anemia virus.
Journal of clinical microbiology    May 2, 2000   Volume 38, Issue 5 1854-1859 doi: 10.1128/JCM.38.5.1854-1859.2000
Tencza SB, Islam KR, Kalia V, Nasir MS, Jolley ME, Montelaro RC.The control of equine infectious anemia virus (EIAV) infections of horses has been over the past 20 years based primarily on the identification and elimination of seropositive horses, predominantly by a standardized agar gel immunodiffusion (AGID) assay in centralized reference laboratories. This screening for EIAV-seropositive horses has been to date hindered by the lack of a rapid diagnostic format that can be easily employed in the field. We describe here the development of a rapid solution-phase assay for the presence of serum antibodies to EIAV based on fluorescence polarization (FP) (pat...
Effect of nervous excitation on acid secretion in horses.
Acta physiologica Scandinavica    March 11, 2000   Volume 168, Issue 3 437-442 doi: 10.1046/j.1365-201x.2000.00682.x
Sandin A, Andrews FM, Nadeau JA, Nilsson G.Nervous excitation was induced by various means in horses provided with a gastric cannula. Insulin hypoglycaemia profoundly inhibited the basal acid output and volume secreted from the stomach. No clear effect on acid secretion was noted after administration of bethanechol, as the acid output was covered by the copious secretion of saliva. Atropine almost abolished the basal acid output. Sensoric stimulation by teasing caused a slight but not significant increase in the total acid output. These data suggest that cholinergic excitation might play a role in the stimulation of both volume and aci...
Effect of exercise on concentrations of immunoreactive endothelin in bronchoalveolar lavage fluid of normal horses and horses with chronic obstructive pulmonary disease.
Equine veterinary journal. Supplement    February 5, 2000   Issue 30 92-95 doi: 10.1111/j.2042-3306.1999.tb05196.x
Benamou AE, Art T, Marlin DJ, Roberts CA, Lekeux P.Chronic obstructive pulmonary disease (COPD) represents a major cause of loss of performance in the horse. The role of endothelin (ET), a potent bronchoconstrictive and vasoactive peptide, is currently being investigated in asthma and other obstructive respiratory diseases in man. We have previously found elevated systemic and pulmonary endothelin levels in horses during exacerbation of COPD. In the present study, our aim was to examine possible variations in ET concentrations occurring during exercise in COPD horses. We compared the effects of intense treadmill exercise on the recovery of end...
The distribution of nerve fibres immunoreactive for vasoactive intestinal peptide, calcitonin gene-related peptide, substance P and dopamine beta-hydroxylase in the normal equine larynx.
Research in veterinary science    December 23, 1999   Volume 67, Issue 3 251-259 doi: 10.1053/rvsc.1999.0325
Corcoran BM, Jarvis S, Hahn CN, Mayhew IG.The autonomic innervation of the mammalian respiratory system is complex, and involves a wide variety of peptide and non-peptide neurotransmitters which will have an important role in normal laryngeal function and the response to disease. This innervation has been partially described in the horse airway and lung, but there is no information on the equine larynx. This paper describes the expression and distribution of nerve fibres immunoreactive for vasoactive intestinal peptide (VIP), calcitonin gene-related peptide (CGRP), substance P (SP) and the adrenergic enzymatic marker dopamine beta-hyd...
Mass accuracy and sequence requirements for protein database searching.
Analytical biochemistry    November 5, 1999   Volume 275, Issue 1 39-46 doi: 10.1006/abio.1999.4270
Green MK, Johnston MV, Larsen BS.To elucidate the role of high mass accuracy in mass spectrometric peptide mapping and database searching, selected proteins were subjected to tryptic digestion and the resulting mixtures were analyzed by electrospray ionization on a 7 Tesla Fourier transform mass spectrometer with a mass accuracy of 1 ppm. Two extreme cases were examined in detail: equine apomyoglobin, which digested easily and gave very few spurious masses, and bovine alpha-lactalbumin, which under the conditions used, gave many spurious masses. The effectiveness of accurate mass measurements in minimizing false protein match...
Novel cathelicidins in horse leukocytes(1).
FEBS letters    September 3, 1999   Volume 457, Issue 3 459-464 doi: 10.1016/s0014-5793(99)01097-2
Scocchi M, Bontempo D, Boscolo S, Tomasinsig L, Giulotto E, Zanetti M.Cathelicidins are precursors of defense peptides of the innate immunity and are widespread in mammals. Their structure comprises a conserved prepropiece and an antimicrobial domain that is structurally varied both intra- and inter-species. We investigated the complexity of the cathelicidin family in horse by a reverse transcription-PCR-based cloning strategy of myeloid mRNA and by Southern and Western analyses. Three novel cathelicidin sequences were deduced from bone marrow mRNA and designated equine cathelicidins eCATH-1, eCATH-2 and eCATH-3. Putative antimicrobial domains of 26, 27 and 40 r...
Gag protein epitopes recognized by CD4(+) T-helper lymphocytes from equine infectious anemia virus-infected carrier horses.
Journal of virology    April 10, 1999   Volume 73, Issue 5 4257-4265 doi: 10.1128/JVI.73.5.4257-4265.1999
Lonning SM, Zhang W, McGuire TC.Antigen-specific T-helper (Th) lymphocytes are critical for the development of antiviral humoral responses and the expansion of cytotoxic T lymphocytes (CTL). Identification of relevant Th lymphocyte epitopes remains an important step in the development of an efficacious subunit peptide vaccine against equine infectious anemia virus (EIAV), a naturally occurring lentivirus of horses. This study describes Th lymphocyte reactivity in EIAV carrier horses to two proteins, p26 and p15, encoded by the relatively conserved EIAV gag gene. Using partially overlapping peptides, multideterminant and poss...
Presence and comparison of angiotensin converting enzyme in commercial cell culture sera.
Biochemistry and molecular biology international    March 27, 1999   Volume 47, Issue 1 107-115 doi: 10.1080/15216549900201103
Bramucci M, Miano A, Quassinti L, Maccari E, Murri O, Amici D.This study was conducted to determine the presence of the angiotensin converting enzyme in commercial sera used in cell culture medium. The aim of the research was to bring the presence of proteinases (angiotensin converting enzyme) to cell culture users' knowledge and to give some data for solving problems about the development of peptides as useful drugs. The enzymes, purified from foetal bovine, adult bovine, foetal equine, adult equine, and human sera, showed molecular weights of about 170 kDa. Captopril and lisinopril inhibited enzyme activities at nanomolar concentrations. The enzymes we...
Innervation of the equine mature and immature proximal sesamoid bone by calcitonin gene-related peptide and substance P-containing nerves.
American journal of veterinary research    November 26, 1998   Volume 59, Issue 11 1378-1385 
Cornelissen BP, Buma P, Rijkenhuizen AB, Barneveld A.To localize and determine relative frequency of occurrence of calcitonin gene-related peptide (CGRP) and substance P (SP) fibers in the proximal sesamoid bones (PSB) and adjacent structures in sound horses. Methods: 4 foals and 3 adult horses. Methods: Medial PSB and adjacent ligaments of both forelimbs were collected, flushed, and fixed in buffered 4% formalin. The left PSB were cut into 5 longitudinal, sagittally oriented slabs, and the right PSB were cut into 5 transverse slabs. After decalcification in EDTA, slices were transferred to a 30% sucrose solution, deep frozen, sectioned (80 micr...
Gag protein epitopes recognized by ELA-A-restricted cytotoxic T lymphocytes from horses with long-term equine infectious anemia virus infection.
Journal of virology    November 13, 1998   Volume 72, Issue 12 9612-9620 doi: 10.1128/JVI.72.12.9612-9620.1998
Zhang W, Lonning SM, McGuire TC.Most equine infectious anemia virus (EIAV)-infected horses have acute clinical disease, but they eventually control the disease and become lifelong carriers. Cytotoxic T lymphocytes (CTL) are considered an important immune component in the control of infections with lentiviruses including EIAV, but definitive evidence for CTL in the control of disease in carrier horses is lacking. By using retroviral vector-transduced target cells expressing different Gag proteins and overlapping synthetic peptides of 16 to 25 amino acids, peptides containing at least 12 Gag CTL epitopes recognized by virus-st...
Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test to detect the presence of antibodies to equine arteritis virus.
Journal of virological methods    October 10, 1998   Volume 73, Issue 2 175-183 doi: 10.1016/s0166-0934(98)00057-3
Iniguez P, Zientara S, Marault M, Machin IB, Hannant D, Cruciere C.A random hexapeptide fusion-phage library was screened to isolate phages that bind to antibodies present in horse sera positive for equine arteritis virus (EAV). Analysis of the peptide sequences displayed by isolated phages identified seven groups. 25% of the isolated phages used as antigens in an ELISA test were specifically recognised by a pool of sera which was positive for EAV in virus neutralisation test (VN). Five of these, when used as antigen in ELISA, detected greater than 50% of sera (n = 30) containing antibodies to EAV as detected by VN. When these five phages were pooled together...
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
Discrimination of mammalian growth hormones by peptide-mass mapping.
Rapid communications in mass spectrometry : RCM    July 31, 1998   Volume 12, Issue 14 975-981 doi: 10.1002/(SICI)1097-0231(19980731)12:14<975::AID-RCM263>3.0.CO;2-H
Laidler P, Cowan DA, Houghton E, Kicman AT, Marshall DE.Recognition by the legal authorities that growth hormones (GHs) may be abused to improve sporting performance and/or physique has led to the implementation of controls that make it an offence to produce, supply, possess or import and export GHs, with intent to supply, without the authority to do so. A method is described for the discriminatory analysis of human, equine, porcine and bovine GHs for forensic purposes. Peptide-mass mapping by matrix-assisted laser desorption/ionization (MALDI) time-of-flight (TOF) mass spectrometry following tryptic digestion gave sequence coverages of 97.4%, 93.7...
Cortisol, peptides and catecholamines in cerebrospinal fluid, pituitary effluent and peripheral blood of ponies.
Equine veterinary journal    April 16, 1998   Volume 30, Issue 2 166-169 doi: 10.1111/j.2042-3306.1998.tb04478.x
Luna SP, Taylor PM.Cannulation of the pituitary effluent in horses is a useful method for investigating the release of pituitary hormones in loco (Irvine and Alexander 1987). Adrenocorticotropic hormone (ACTH) and arginine vasopression (AVP) concentrations in plasma collected from the intercavemous sinus, which receives all the pituitary outflow, were several times greater than those measured in peripheral plasma (Redekopp et at 1986). However, no studies evaluating the pituitary contribution to endogenous opioid secretion have been reported in the equine species. Cerebrospinal fluid (CSF) directly reflects CNS ...
Priming induces functional coupling of N-formyl-methionyl-leucyl-phenylalanine receptors in equine neutrophils.
Journal of leukocyte biology    March 21, 1998   Volume 63, Issue 3 380-388 doi: 10.1002/jlb.63.3.380
Brazil TJ, Rossi AG, Haslett C, McGorum B, Dixon PM, Chilvers ER.The synthetic formylpeptide fMLP is widely used as a model chemoattractant and secretagogue for mammalian neutrophils. Despite possessing fMLP receptors, equine neutrophils do not produce superoxide anions in response to fMLP and there is no inflammatory reaction in the horse when fMLP is injected intradermally. The functional capability of these receptors was investigated after pretreatment with recognized priming agents. Purified neutrophils were pretreated with lipopolysaccharide (LPS), platelet-activating factor (PAF), or tumor necrosis factor alpha (TNF-alpha) and superoxide anion generat...
Mechanism of capsaicin-induced relaxation in equine tracheal smooth muscle.
The American journal of physiology    December 31, 1997   Volume 273, Issue 5 L997-L1001 doi: 10.1152/ajplung.1997.273.5.L997
Zhu FX, Zhang XY, Olszewski MA, Robinson NE.The effects of capsaicin and neuropeptides were examined in equine tracheal smooth muscle (TSM). Neither capsaicin nor substance P (SP) contracted TSM. Capsaicin (100 microM) elicited relaxation in TSM contracted with methacholine. This relaxation was not mimicked by SP or calcitonin gene-related peptide (CGRP). Relaxation was not attenuated by removal of the epithelium or by pretreatment of tissue with meclofenamate or the nitric oxide (NO) synthase inhibitor NG-nitro-L-arginine. Previous exposure of TSM to capsaicin did not eliminate the relaxation responses to subsequent capsaicin. Although...
Equine infectious anemia virus utilizes a YXXL motif within the late assembly domain of the Gag p9 protein.
Journal of virology    September 1, 1997   Volume 71, Issue 9 6541-6546 doi: 10.1128/JVI.71.9.6541-6546.1997
Puffer BA, Parent LJ, Wills JW, Montelaro RC.We have previously demonstrated that the Gag p9 protein of equine infectious anemia virus (EIAV) is functionally homologous with Rous sarcoma virus (RSV) p2b and human immunodeficiency virus type 1 (HIV-1) p6 in providing a critical late assembly function in RSV Gag-mediated budding from transfected COS-1 cells (L. J. Parent et al., J. Virol. 69:5455-5460, 1995). In light of the absence of amino acid sequence homology between EIAV p9 and the functional homologs of RSV and HIV-1, we have now designed an EIAV Gag-mediated budding assay to define the late assembly (L) domain peptide sequences con...
Tachykinin receptors in the equine pelvic flexure.
Equine veterinary journal    July 1, 1997   Volume 29, Issue 4 306-312 doi: 10.1111/j.2042-3306.1997.tb03128.x
Sonea IM, Wilson DV, Bowker RM, Robinson NE.Tachykinins, of which substance P (SP) is the prototype, are neuropeptides which are widely distributed in the nervous systems. In the equine gut, SP is present in enteric nerves and is a powerful constrictor of enteric muscle; in other species, SP is also known to have potent vasodilatory and pro-inflammatory effects. The specific effects of SP are determined by the subtype of receptor present in the target tissue. There are 3 known subtypes of tachykinin receptors, distinguished by their relative affinities for SP and other tachykinins. The distribution of SP binding sites in the equine pelv...
1 9 10 11 12 13 18