Analyze Diet

Topic:Biochemistry

The study of biochemistry in horses encompasses the chemical processes and substances that occur within equine organisms. This field investigates the molecular interactions and pathways that are fundamental to horse physiology, including metabolism, enzyme activity, and genetic expression. Key areas of interest include the examination of metabolic disorders, nutrient absorption, and the biochemical basis of muscle function and energy production. Researchers utilize biochemical analysis to understand health and disease mechanisms in horses, contributing to the development of diagnostic tools and therapeutic strategies. This page gathers peer-reviewed studies and scholarly articles that explore various biochemical processes and their implications for equine health and performance.
Evidence that commercial calf and horse sera can contain substantial amounts of trans-10,cis-12 conjugated linoleic acid.
Lipids    September 4, 1998   Volume 33, Issue 8 817-819 doi: 10.1007/s11745-998-0275-x
Park Y, Pariza MW.We analyzed fetal calf, newborn calf, horse, and adult cow sera for conjugated linoleic acid (CLA). All sera samples contained CLA, but the amounts varied. The predominant isomer was cis-9,trans-11 CLA but some samples appeared to contain substantial amounts of an isomer with the retention time of trans-10,cis-12 CLA.
Development of an ELISA to assess the potency of horse therapeutic polyvalent antibothropic antivenom.
Toxicon : official journal of the International Society on Toxinology    September 2, 1998   Volume 36, Issue 10 1363-1370 doi: 10.1016/s0041-0101(98)00014-2
Heneine LG, Carvalho AD, Barbosa CF, Arávjo dos Santos MR.The objective of this study was the search for a suitable venom antigen to be used in an in vitro alternative immunoassay, to the standard antivenom neutralization assay using mice. Bothrops jararaca venom was fractionated in DEAE-Sephacel columns and the fractions were tested for a correlation between antibody capture enzyme linked immunosorbent assay (ELISA) absorbance values and the 'in vivo' antivenom potency. Individual antivenoms from 14 horses and 15 separate FUNED polyspecific Bothrops ampouled antivenoms (final product) were used. Fractions showing the higher correlations were further...
Neutralizing potency of horse antibothropic antivenom. Correlation between in vivo and in vitro methods.
Toxicon : official journal of the International Society on Toxinology    September 2, 1998   Volume 36, Issue 10 1433-1439 doi: 10.1016/s0041-0101(98)00077-4
Maria WS, Cambuy MO, Costa JO, Velarde DT, Chávez-Olórtegui C.The correlation coefficients between in vivo neutralization of lethal toxicity (ED50), neutralization of the hemolytic activity (PLA2) and levels of antibodies measured by ELISA, was investigated to test the potency of horse anti-bothropic antivenom. Twenty six horses were hyperimmunized with Bothrops venoms (B. alternatus, B. jararaca, B. jararacussu, B. neuwiedii and B. moojeni). To set up an indirect ELISA, for neutralization of PLA2 activity and for determination of ED50 in Swiss mice, the whole Bothrops jararaca venom (reference venom for assessing the bothropic antivenom potency in Brazi...
[Population genetic parameters of aboriginal Yakut horses as related to modern breeds of the domestic horse Equus caballus L].
Genetika    August 28, 1998   Volume 34, Issue 6 796-809 
Tikhonov VN, Cothran EG, Kniazev SP.This study was the first to analyze the polymorphic characteristics of a wide range of biochemical markers in aboriginal Yakut horses. A total of 124 alleles, including 48 alleles of seven blood-group loci and 76 alleles of ten loci for enzymes and other proteins, were studied. For these polymorphic systems, a computer analysis of the genetic distances between 85 horse breeds of different origin from all parts of the world was performed. The low level of hereditary variation in the Yakut horses confirmed that this breed is old and has long been an isolated population. Phylogenetic analysis dem...
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
Effect of intravenous calcium administration on gentamicin-induced nephrotoxicosis in ponies.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 1055-1062 
Brashier MK, Geor RJ, Ames TR, O'Leary TP.To determine whether supplemental i.v. calcium administration would attenuate or prevent gentamicin-induced acute renal failure, defined as an increase in serum creatinine concentration > or = 50% above baseline. Methods: 10 healthy pony mares. Methods: Pony mares were randomly assigned to receive calcium at a dosage of 20 mg/kg of body weight or saline solution i.v., twice daily for 14 days. All pony mares received gentamicin at a dosage of 20 mg/kg i.v. every 8 hours for 14 days. Gentamicin pharmacokinetic, serum biochemical, and urinalysis data were measured every other day for the 14-da...
Transfer of a uterine lipocalin from the endometrium of the mare to the developing equine conceptus.
Biology of reproduction    August 26, 1998   Volume 59, Issue 3 483-490 doi: 10.1095/biolreprod59.3.483
Crossett B, Suire S, Herrler A, Allen WR, Stewart F.One of the major, progesterone-dependent proteins secreted into the uterine lumen of the mare is a 19-kDa lipocalin (P19). It associates strongly with the embryonic capsule that envelops the young horse conceptus in early gestation, suggesting that it may be involved in sustaining early development. However, it was not known whether the protein was transported through the capsule and/or trophoblast layer and into the yolk sac cavity. To address this question, polyclonal antisera were raised against a C-terminal peptide (based on the deduced amino acid sequence of P19) and a recombinant-derived...
The potential of collagenase as a new therapy for separation of human retained placenta: hydrolytic potency on human, equine and bovine placentae.
Placenta    August 12, 1998   Volume 19, Issue 5-6 379-383 doi: 10.1016/s0143-4004(98)90077-7
Fecteau KA, Haffner JC, Eiler H.The purpose of this study was to determine to what degree bacterial collagenase may digest human placentae compared to equine and bovine placentae. Placenta samples from human, equine and bovine were incubated with bacterial collagenase solution at various concentrations. The degree of hydrolysis and collagen breakdown was measured by the release of total proteins and hydroxyproline into the incubation media. Also, whole placentae were injected via umbilical cord arteries with collagenase solution (200 U/ml, 200 ml total volume in human and 1000 ml in equine) and hydrolysis determined chemical...
Nitrergic relaxation of the horse corpus cavernosum. Role of cGMP.
European journal of pharmacology    August 11, 1998   Volume 351, Issue 1 85-94 doi: 10.1016/s0014-2999(98)00282-9
Recio P, López PG, Hernández M, Prieto D, Contreras J, García-Sacristán A.The involvement of nitric oxide (NO) and the mechanisms mediating neurogenic relaxation were investigated in the horse corpus cavernosum. NADPH-diaphorase activity was expressed in nerve fibres around arteries and muscular bundles in the horse trabecular tissue. Relaxations in response to electrical field stimulation were tetrodotoxin (10(-6) M)-sensitive, indicating their neurogenic origin. The NO synthase inhibitor, L-NO-arginine (L-NO-Arg, 3 x 10(-5) M), abolished the electrically induced relaxations, which were significantly reversed by L-arginine (3 x 10(-3) M). Exogenous NO (10(-6)-10(-3...
Triiodothyronine (T3), insulin and characteristics of 5′-monodeiodinase (5′-MD) in mare’s milk from parturition to 21 days post-partum.
Reproduction, nutrition, development    August 11, 1998   Volume 38, Issue 3 235-244 doi: 10.1051/rnd:19980303
Slebodziński AB, Brzezińska-Slebodzińska E, Nowak J, Kowalska K.It is generally accepted that hormones and tissue growth factors are supplied from mother to neonate via mammary secretion. Among the protein hormones, insulin and prolactin are considered as the most important milk components for neonates. The significance of the thyroid hormones, namely triiodothyronine (T3) generated locally by 5'-monodeiodinase (5'-MD) in the mammary tissues, for the mammary gland itself and for suckling neonates is still under consideration. In the present study the activity of the 5'-MD and the concentrations of T3 and insulin in mare's colostrum and milk during the firs...
Characterization of a O-fatty-acylated sulfatide from equine brain.
European journal of biochemistry    August 6, 1998   Volume 255, Issue 1 289-295 doi: 10.1046/j.1432-1327.1998.2550289.x
Mikami T, Tsuchihashi K, Kashiwagi M, Yachida Y, Daino T, Hashi K, Akino T, Gasa S.A sulfatide, O-fatty-acylated 3-sulfogalactosylceramide at C6-O on galactoside, was isolated from equine brain and the chemical structure was characterized by proton NMR and MS. The O-acylation site of the acylated sulfatide was determined by the down-field shift of protons attached to a carbon having an O-acyl group in the NMR spectrum and by analysis of a partially methylated derivative before and after acetalization of the intact sulfatide using GC-MS. The O-acyl chain length was determined by GLC, revealing that it exclusively had palmitoyl and stearoyl residues as the major fatty acids. T...
The effect of social stress on adrenal axis activity in horses: the importance of monitoring corticosteroid-binding globulin capacity.
The Journal of endocrinology    August 6, 1998   Volume 157, Issue 3 425-432 doi: 10.1677/joe.0.1570425
Alexander SL, Irvine CH.Plasma cortisol is largely bound to corticosteroid-binding globulin (CBG), which regulates its bioavailability by restricting exit from capillaries. Levels of CBG may be altered by several factors including stress and this can influence the amount of cortisol reaching cells. This study investigated the effect of social instability on plasma concentrations of CBG, total and free (not protein bound) cortisol in horses. Horses new to our research herd ('newcomers') were confined in a small yard with four dominant resident horses for 3-4 h daily for 3-4 (n = 5) or 9-14 (n = 3) days. Jugular blood ...
The effects of intra-articular methylprednisolone and exercise on the mechanical properties of articular cartilage in the horse.
Osteoarthritis and cartilage    August 6, 1998   Volume 6, Issue 2 106-114 doi: 10.1053/joca.1997.0100
Murray RC, DeBowes RM, Gaughan EM, Zhu CF, Athanasiou KA.Intra-articular corticosteroids are widely used as anti-inflammatory agents for symptomatic management of arthritis, but their administration with concurrent exercise remains controversial. Biochemical and morphologic analysis of treated cartilage has revealed conflicting results, but previous biomechanical assessment has not been undertaken. Objective: To compare the biomechanical properties of intra-articular methylprednisolone acetate (MPA) and diluent treated cartilage in treadmill exercised horses. Methods: Eight 2-year-old female horses had MPA or diluent administered into contralateral ...
Regional differences in endothelial function in horse lungs: possible role in blood flow distribution?
Journal of applied physiology (Bethesda, Md. : 1985)    August 4, 1998   Volume 85, Issue 2 537-542 doi: 10.1152/jappl.1998.85.2.537
Pelletier N, Robinson NE, Kaiser L, Derksen FJ.We investigated regional differences of in vitro responses of pulmonary arteries (6-mm OD) from the dorsocaudal (top) and cranioventral (bottom) lung regions to endothelium-dependent vasodilators (methacholine, bradykinin, and calcium ionophore A-23187). Methacholine relaxed endothelium-intact top vessels; however, in bottom vessels, a small relaxation preceded a profound contraction. In top vessels, removal of endothelial cells converted relaxation to contraction, and in bottom vessels it abolished relaxation and enhanced contraction. Bradykinin and A-23187 were more potent and caused greater...
Fusion pore expansion in horse eosinophils is modulated by Ca2+ and protein kinase C via distinct mechanisms.
The EMBO journal    August 4, 1998   Volume 17, Issue 15 4340-4345 doi: 10.1093/emboj/17.15.4340
Scepek S, Coorssen JR, Lindau M.Using the patch-clamp technique, we studied the role of protein phosphorylation and dephosphorylation on the exocytotic fusion of secretory granules with the plasma membrane in horse eosinophils. Phorbol 12-myristate 13-acetate (PMA) had no effect on the amplitude and dynamics of degranulation, indicating that the formation of fusion pores is insensitive to activation of protein kinase C (PKC). Fusion pore expansion, however, was accelerated approximately 2-fold by PMA, and this effect was abolished by staurosporine. Elevating intracellular Ca2+ to 1.5 microM also resulted in a 2-fold accelera...
Discrimination of mammalian growth hormones by peptide-mass mapping.
Rapid communications in mass spectrometry : RCM    July 31, 1998   Volume 12, Issue 14 975-981 doi: 10.1002/(SICI)1097-0231(19980731)12:14<975::AID-RCM263>3.0.CO;2-H
Laidler P, Cowan DA, Houghton E, Kicman AT, Marshall DE.Recognition by the legal authorities that growth hormones (GHs) may be abused to improve sporting performance and/or physique has led to the implementation of controls that make it an offence to produce, supply, possess or import and export GHs, with intent to supply, without the authority to do so. A method is described for the discriminatory analysis of human, equine, porcine and bovine GHs for forensic purposes. Peptide-mass mapping by matrix-assisted laser desorption/ionization (MALDI) time-of-flight (TOF) mass spectrometry following tryptic digestion gave sequence coverages of 97.4%, 93.7...
Progesterone in mare follicular fluid induces the acrosome reaction in stallion spermatozoa and enhances in vitro binding to the zona pellucida.
International journal of andrology    July 24, 1998   Volume 21, Issue 2 57-66 doi: 10.1046/j.1365-2605.1998.00096.x
Cheng FP, Fazeli AR, Voorhout WF, Tremoleda JL, Bevers MM, Colenbrander B.The aim of this study was to investigate whether mare follicular fluid (FF) induces the acrosome reaction (AR) in stallion spermatozoa and, if so, to identify the component in FF responsible for it. Furthermore, the effect of this component on sperm-zona binding and the subsequent AR was studied. Pooled FF, aspirated from the preovulatory follicles of mares in oestrous, was used and aliquots of the fluid were treated with charcoal to remove steroids (CFF). Charcoal treatment reduced the progesterone concentration in FF from 153 to < 2 ng/mL. Spermatozoa from fertile stallions collected by a...
Elastic modulus of equine hoof horn, tested in wall samples, sole samples and frog samples at varying levels of moisture.
Berliner und Munchener tierarztliche Wochenschrift    July 23, 1998   Volume 111, Issue 6 217-221 
Hinterhofer C, Stanek C, Binder K.The elastic (E-) modulus of hoof horn samples as a function of moisture content was determined from different segments of the equine hoof. 110 hoof horn specimens with different pigmentation taken from six adult warm-blooded horses with no obvious pathological changes within t he foot were used for the 177 tension and bending tests which were performed in accordance with ASTM D 5026, ASTM D 5023 and DIN 53.457. E-moduli were determined under physiological conditions with mean 761.8, SD +/- 295.4 N/mm for dorsal wall samples, 708 +/- 280.4 N/mm2 for lateral wall samples, 230 +/- 92.4 N/mm2 for ...
Inhibition of glutathione S-transferase activity by the quinoid metabolites of equine estrogens.
Chemical research in toxicology    July 22, 1998   Volume 11, Issue 7 758-765 doi: 10.1021/tx9702190
Chang M, Zhang F, Shen L, Pauss N, Alam I, van Breemen RB, Blond SY, Bolton JL.The risk factors for women developing breast and endometrium cancers are all associated with a lifetime of estrogen exposure. Estrogen replacement therapy (ERT) in particular has been correlated with a slight increased cancer risk, although the numerous benefits of ERT may negate this harmful side effect. Equilenin and equilin are equine estrogens which make up between 30% and 45% of the most widely prescribed estrogen replacement formulation, Premarin (Wyeth-Ayerst). In this study we have synthesized the catechol metabolites of equilenin [4-hydroxyequilenin (4-OHEN)] and equilin [4-hydroxyequ...
The activity of mixed function oxidases, estimated by in vivo antipyrine clearance, is similar in horses and camels.
Comparative biochemistry and physiology. Part C, Pharmacology, toxicology & endocrinology    July 21, 1998   Volume 119, Issue 2 139-142 doi: 10.1016/s0742-8413(97)00200-4
Wasfi IA, Zorob OM, Boni NS, Hadi AA, Agha BA, Elghazali M.The activity of hepatic mixed function oxidases was compared in horses and camels (Camelus dromedarius) by studying the pharmacokinetics of antipyrine in seven camels and five horses following intravenous administration of a single dose of antipyrine (25 mg/kg). The data obtained (mean +/- SEM and median in brackets) in camels and horses, respectively, were as follows: the elimination half-lives were 3.25 +/- 0.23 (3.19) and 3.09 +/- 0.25 (2.90) hr; the apparent volumes of distribution (area method) were 0.691 +/- 0.045 (0.648) and 0.642 +/- 0.034 (0.676) l/kg; the volumes of distribution at s...
Endometrial connexin expression in the mare and pig: evidence for the suppression of cell-cell communication in uterine luminal epithelium.
The Anatomical record    July 21, 1998   Volume 251, Issue 3 277-285 doi: 10.1002/(SICI)1097-0185(199807)251:3<277::AID-AR1>3.0.CO;2-T
Day WE, Bowen JA, Barhoumi R, Bazer FW, Burghardt RC.This investigation examines the relationship between implantation strategy and gap junction protein expression in uterine endometrium. The pattern of gap junction and connexin protein expression was analyzed in porcine and equine endometrium from cycling and pregnant animals using electron microscopy and immunocytochemistry. Functional analysis of cell-cell communication was also monitored by laser cytometry in primary cultures of endometrial epithelial cells. Gap junctions were detected in endometrial stroma of cycling and pregnant animals, which was correlated with immunoreactive Cx43 within...
Maturation-promoting factor (MPF) and mitogen activated protein kinase (MAPK) expression in relation to oocyte competence for in-vitro maturation in the mare.
Molecular human reproduction    July 17, 1998   Volume 4, Issue 6 563-570 doi: 10.1093/molehr/4.6.563
Goudet G, Belin F, Bézard J, Gérard N.In the equine species, a large proportion of oocytes fail to complete meiosis during in-vitro culture. The biochemical and molecular basis of this failure is unknown. The meiotic cell cycle is controlled in part by the maturation-promoting factor (MPF) and the mitogen-activated protein kinase (MAPK). In this study, we evaluated the oocyte competence for in-vitro maturation and the expression of MPF components (p34cdc2 and cyclin B) and MAPK after in-vitro culture. The maturation rate was influenced by the culture medium and the physiological stage of the mare at the time of oocyte recovery. We...
Loading-induced changes in synovial fluid affect cartilage metabolism.
British journal of rheumatology    July 17, 1998   Volume 37, Issue 6 671-676 doi: 10.1093/rheumatology/37.6.671
Van den Hoogen BM, van de Lest CH, van Weeren PR, Lafeber FP, Lopes-Cardozo M, van Golde LM, Barneveld A.The purpose of this study was to determine whether changes in the synovial fluid (SF) induced by in vivo loading can induce an alteration in the metabolic activity of chondrocytes in vitro. Therefore, SF was collected from ponies after a period of box rest and after they had exercise for a week. Normal, unloaded articular cartilage explants were cultured in 20% solutions of these SFs for 4 days and chondrocyte activity was determined by glycosaminoglycan (GAG) turnover. In explants cultured in post-exercise SF, GAG synthesis was enhanced and GAG release was diminished when compared to cultures...
Changes in third carpal bone articular cartilage after synovectomy in normal and inflamed joints.
Veterinary surgery : VS    July 15, 1998   Volume 27, Issue 4 321-330 doi: 10.1111/j.1532-950x.1998.tb00134.x
Palmer JL, Bertone AL, Malemud CJ, Mansour J.To determine if arthroscopic synovectomy in normal and inflamed joints had temporal or site-related effects on articular cartilage. Methods: Alterations in equine third carpal bone articular cartilage were studied at two time periods: groups 1 and 2 (6 weeks) and groups 3 and 4 (2 weeks) after synovectomy in normal (groups 2 and 4) and inflamed carpi (groups 1 and 3). Methods: 16 carpi from eight horses. Methods: Biochemical and biomechanical properties of dorsal and palmar articular cartilage were determined by radioloabeling, proteoglycan (PG) extraction, chromatography, electrophoresis, and...
Comparison of anion gap and strong ion gap as predictors of unmeasured strong ion concentration in plasma and serum from horses.
American journal of veterinary research    July 11, 1998   Volume 59, Issue 7 881-887 
Constable PD, Hinchcliff KW, Muir WW.To compare the accuracy of anion gap (AG) and strong ion gap (SIG) for predicting unmeasured strong ion concentration in plasma and serum from horses. Methods: 6 well-trained Standardbred horses undergoing high-intensity exercise (experimental study) and 78 horses and ponies that underwent i.v. administration of lactic acid or endotoxin, and endurance, submaximal, or high-intensity exercise. Methods: Anion gap was calculated as AG = (Na+ + K+) - (Cl- + HCO3-), and SIG was calculated, using the simplified strong ion model, whereby SIG (mEq/L) = 2.24 x total protein (g/dl)/(1 + 10(6.65-pH)) - AG...
Influence of exogenous hyaluronan on synthesis of hyaluronan and collagenase by equine synoviocytes.
American journal of veterinary research    July 11, 1998   Volume 59, Issue 7 888-892 
Lynch TM, Caron JP, Arnoczky SP, Lloyd JW, Stick JA, Render JA.To evaluate the influence of exogenous hyaluronan (HA) on in vitro synthesis of HA and collagenase by equine synoviocytes from normal and inflamed joints. Methods: 9 adult horses. Methods: Synoviocytes for culture were taken from the middle carpal joint of 3 horses with normal joints (control) and 6 horses with osteochondral fractures (principal). Synoviocytes were propagated in monolayer cultures and were incubated with 3 commercial HA products at concentrations of 0, 200, 400, and 1,500 micrograms/ml. Newly synthesized HA was radiolabeled with [3H]glucosamine and quantified by cetylpyridiniu...
Gelatinolytic activity in tracheal epithelial lining fluid and in blood from horses with chronic obstructive pulmonary disease.
American journal of veterinary research    July 11, 1998   Volume 59, Issue 7 818-823 
Raulo SM, Maisi P.To determine whether gelatinolytic activity in tracheal epithelial lining fluid (TELF), blood neutrophils, and blood lymphocytes from horses was metalloprotease activity, and to compare, for healthy horses and horses with chronic obstructive pulmonary disease, gelatinolytic activity in neutrophils, lymphocytes, and serum with activity in TELF. Methods: 7 horses with chronic obstructive pulmonary disease (COPD) and 4 healthy control horses. Methods: Neutrophils and lymphocytes were obtained by means of Percoll separation. Zymography was used to detect gelatinolytic activity; EDTA inhibition and...
Effects of a sudden flow reduction on red blood cell rouleau formation and orientation using RF backscattered power.
Ultrasound in medicine & biology    July 4, 1998   Volume 24, Issue 4 503-511 doi: 10.1016/s0301-5629(98)00019-2
Qin Z, Durand LG, Allard L, Cloutier G.In most studies that were aimed at evaluating the kinetics of red blood cell (RBC) aggregation, human blood was initially circulated at a high shear rate to disrupt the aggregates, and measurements were performed following a complete flow stoppage, during the process of rouleau formation. However, it is known that a very low shear rate can enhance the formation of aggregates, as demonstrated by the modal relationship of the shear-rate dependence of RBC aggregation. The objective of the present study was, thus, to evaluate the influence of sudden flow reductions compared to a complete flow stop...
Determination of the volume changes for pressure-induced transitions of apomyoglobin between the native, molten globule, and unfolded states.
Biophysical journal    July 2, 1998   Volume 75, Issue 1 463-470 doi: 10.1016/S0006-3495(98)77534-4
Vidugiris GJ, Royer CA.The volume change for the transition from the native state of horse heart apomyoglobin to a pressure-induced intermediate with fluorescence properties similar to those of the well-established molten globule or I form was measured to be -70 ml/mol. Complete unfolding of the protein by pressure at pH 4.2 revealed an upper limit for the unfolding of the intermediate of -61 ml/mol. At 0.3 M guanidine hydrochloride, the entire transition from native to molten globule to unfolded state was observed in the available pressure range below 2.5 kbar. The volume change for the N-->I transition is relat...
Comparative narrow-bore high-performance liquid chromatographic determination of ketoprofen in horse plasma.
Biomedical chromatography : BMC    July 1, 1998   Volume 12, Issue 3 167-169 doi: 10.1002/(SICI)1099-0801(199805/06)12:3<167::AID-BMC798>3.0.CO;2-5
Baeyens WR, Van der Weken G, Van Overbeke A, Corveleyn S, Remon JP, Deprez P.No abstract available