Analyze Diet

Topic:Molecular biology

Molecular biology in horses involves the study of molecular processes and genetic mechanisms that underpin equine physiology and health. This field encompasses the analysis of DNA, RNA, proteins, and other biomolecules to understand gene expression, genetic variation, and cellular functions in horses. Techniques such as genomic sequencing, gene expression profiling, and molecular diagnostics are employed to explore topics like hereditary diseases, performance traits, and immune responses in equines. This page assembles peer-reviewed research studies and scholarly articles that investigate the molecular biology of horses, focusing on genetic research, molecular techniques, and their applications in equine science.
Monitoring the conformational flexibility of cytochrome c at low ionic strength by 1H-NMR spectroscopy.
European journal of biochemistry    October 6, 1998   Volume 256, Issue 2 271-278 doi: 10.1046/j.1432-1327.1998.2560271.x
Banci L, Bertini I, Reddig T, Turano P.Horse heart cytochrome c at pH 7 and low ionic strength is present as two conformers, as evidenced by 1H-NMR spectroscopy. The two structures have been calculated using NOE and pseudocontact shift constraints. They have the same folding patterns and are essentially equal, within the rmsd of the families. The two average structures have rmsd values of 0.049 nm and 0.093 nm for the backbone and the heavy atoms, respectively. Such a difference has been analyzed through a detailed analysis of the NOEs. It appears that the species at low ionic strength differs from the species present at high ionic...
Equine TIMP-1 and TIMP-2: identification, activity and cellular sources.
Equine veterinary journal    October 3, 1998   Volume 30, Issue 5 416-423 doi: 10.1111/j.2042-3306.1998.tb04512.x
Clegg PD, Coughlan AR, Carter SD.Matrix metalloproteinases (MMPs) are the main enzymes involved in connective tissue turnover. Regulation of MMPs is achieved by controlling production, activation of the pro-enzymes together with the presence of inhibitors, such as, tissue inhibitors of metalloproteinases (TIMPS). The presence of TIMPs in equine synovial fluid was assessed by the ability of the fluid to inhibit equine MMP-9 activity using a gelatin degradation ELISA. The cellular source of the TIMPs was determined using culture supernatants of resident articular cells (chondrocytes and synovial fibroblasts) and invading inflam...
Equine CRISP-3: primary structure and expression in the male genital tract.
Biochimica et biophysica acta    September 28, 1998   Volume 1387, Issue 1-2 206-216 doi: 10.1016/s0167-4838(98)00122-8
Schambony A, Gentzel M, Wolfes H, Raida M, Neumann U, Töpfer-Petersen E.Although originally described in the male rodent genital tract, cysteine-rich secretory proteins (CRISPs) are expressed in a variety of mammalian tissue and cell types. The proteins of the male genital tract have been observed associated to spermatozoa and are believed to play a role in mammalian fertilization. Here we describe the identification and primary structure of the first equine member of the CRISP family. Equine CRISP-3 is transcribed and expressed in the stallion salivary gland, in the ampulla and the seminal vesicle. It displays all 16 conserved cysteine residues and shows 82% homo...
[Differentiation of domestic horse and Przewalskis horse using various DNA sequences].
Genetika    September 28, 1998   Volume 34, Issue 7 996-999 
Glazko VI, Zelenaia LB.The electrophoretic mobility of seven erythrocyte enzymes and spectra of fragments amplified by RAPD-PCR with primers UBC-85 and UBC-126 were comparatively analyzed in domestic horse and Przewalski's horse. All tested genetic markers were classified into two groups differing in their involvement in differentiation of the two closely related horse species. Markers from different groups differed neither in their type (a polymorphic protein or an amplification product) nor in their biochemical role (for enzymes).
Carboxymethylated phosphatidylethanolamine in mitochondrial membranes of mammals–evidence for intracellular lipid glycoxidation.
European journal of biochemistry    September 17, 1998   Volume 255, Issue 3 685-689 doi: 10.1046/j.1432-1327.1998.2550685.x
Pamplona R, Requena JR, Portero-Otín M, Prat J, Thorpe SR, Bellmunt MJ.The non-enzymatic modification of aminophospholipids with lipoperoxidation-derived aldehydes and glycoxidation-derived products have been reported previously. However, it remains unknown whether intracellular membranes are damaged by these glycoxidation-derived products. To investigate this issue, we tested whether aminophospholipids from mitochondrial membranes are damaged by glycoxidative stress the mitochondrion being identified as the major site of reactive-species production in the cell. We have used a selected-ion-monitoring/gas-chromatography/mass-spectrometry assay for carboxymethyleth...
The S2 gene of equine infectious anemia virus is dispensable for viral replication in vitro.
Journal of virology    September 12, 1998   Volume 72, Issue 10 8344-8348 doi: 10.1128/JVI.72.10.8344-8348.1998
Li F, Puffer BA, Montelaro RC.Equine infectious anemia virus (EIAV) contains the simplest genome among lentiviruses in that it encodes only three putative regulatory genes (S1, S2, S3) in addition to the canonical gag, pol, and env genes, presumably reflecting its limited tropism to cells of monocyte/macrophage lineage. Tat and Rev functions have been assigned to S1 and S3, respectively, but the specific function for the S2 gene has yet to be determined. Thus, the function of S2 in virus replication in vitro was investigated by using an infectious molecular viral clone, EIAVUK. Various EIAVUK mutants lacking S2 were constr...
Six new cosmid derived and physically mapped equine dinucleotide repeat microsatellites.
Animal genetics    August 28, 1998   Volume 29, Issue 3 236-238 doi: 10.1046/j.1365-2052.1998.00236.x
Marti E, Breen M, Fischer P, Swinburne J, Binns MM.No abstract available
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
Virological and molecular biological investigations into equine herpes virus type 2 (EHV-2) experimental infections.
Virus research    August 26, 1998   Volume 55, Issue 1 101-106 doi: 10.1016/s0168-1702(98)00028-8
Borchers K, Wolfinger U, Ludwig H, Thein P, Baxi S, Field HJ, Slater JD.Two 18-month-old naturally reared ponies were used to investigate the pathogenicity of EHV-2. After dexamethasone treatment, pony 1 was inoculated intranasally with EHV-2 strain T16, which has been isolated from a foal with keratoconjunctivitis superficialis and pony 2 was similarly inoculated with strain LK4 which was originally isolated from a horse with upper respiratory tract disease. Following virus inoculation, pyrexia was not detected in either pony but both developed conjunctivitis, lymphadenopathy, and coughing. EHV-2 was detected in nasal mucus samples up to day 12 post infection (p....
Organization of the equine immunoglobulin heavy chain constant region genes; III. Alignment of c mu, c gamma, c epsilon and c alpha genes.
Immunobiology    August 26, 1998   Volume 199, Issue 1 105-118 doi: 10.1016/s0171-2985(98)80067-3
Wagner B, Overesch G, Sheoran AS, Holmes MA, Richards C, Leibold W, Radbruch A.Previous restriction analysis of cloned equine DNA and genomic DNA of equine peripheral blood mononuclear cells had indicated the existence of one c epsilon, one c alpha and up to six c gamma genes in the haploid equine genome. The c epsilon and c alpha genes have been aligned on a 30 kb DNA fragment in the order 5' c epsilon-c alpha 3'. Here we describe the alignment of the equine c mu and c gamma genes by deletion analysis of one IgM, four IgG and two equine light chain expressing heterohybridomas. This analysis establishes the existence of six c gamma genes per haploid genome. The genomic a...
Transfer of a uterine lipocalin from the endometrium of the mare to the developing equine conceptus.
Biology of reproduction    August 26, 1998   Volume 59, Issue 3 483-490 doi: 10.1095/biolreprod59.3.483
Crossett B, Suire S, Herrler A, Allen WR, Stewart F.One of the major, progesterone-dependent proteins secreted into the uterine lumen of the mare is a 19-kDa lipocalin (P19). It associates strongly with the embryonic capsule that envelops the young horse conceptus in early gestation, suggesting that it may be involved in sustaining early development. However, it was not known whether the protein was transported through the capsule and/or trophoblast layer and into the yolk sac cavity. To address this question, polyclonal antisera were raised against a C-terminal peptide (based on the deduced amino acid sequence of P19) and a recombinant-derived...
Characterization of 24 equine microsatellite loci.
Animal genetics    August 12, 1998   Volume 29, Issue 2 153-156 
van Haeringen WA, van de Goor LH, van der Hout N, Lenstra JA.No abstract available
Diversity of genomic electropherotypes of naturally occurring equine herpesvirus 1 isolates in Argentina.
Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas    August 12, 1998   Volume 31, Issue 6 771-774 doi: 10.1590/s0100-879x1998000600007
Galosi CM, Norimine J, Echeverría MG, Oliva GA, Nosetto EO, Etcheverrigaray ME, Tohya Y, Mikami T.The genomes of 10 equine herpesvirus 1 (EHV-1) strains isolated in Argentina from 1979 to 1991, and a Japanese HH1 reference strain were compared by restriction endonuclease analysis. Two restriction enzymes, BamHI and BglII, were used and analysis of the electropherotypes did not show significant differences among isolates obtained from horses with different clinical signs. This suggests that the EHV-1 isolates studied, which circulated in Argentina for more than 10 years, belong to a single genotype.
Comparative molecular characterization of Corynebacterium pseudotuberculosis of different origin.
Veterinary microbiology    August 8, 1998   Volume 62, Issue 2 135-143 doi: 10.1016/s0378-1135(98)00202-8
Costa LR, Spier SJ, Hirsh DC.Ribotyping and susceptibility to 17 antimicrobial agents were used to compare 37 isolates of Corynebacterium pseudotuberculosis (28 from horses, 1 from cattle, 3 from sheep and 5 from goats) derived from various types of lesions, and different geographic locations. According to the presence of nitrate reductase, all but one isolate from horses reduced nitrate (nitrate-positive), whereas all isolates from sheep and goats were unable to reduce nitrate (nitrate-negative). The ribotype of the nitrate-negative isolate from a horse with ulcerative lymphangitis was identical to all the other isolates...
Characterization of a O-fatty-acylated sulfatide from equine brain.
European journal of biochemistry    August 6, 1998   Volume 255, Issue 1 289-295 doi: 10.1046/j.1432-1327.1998.2550289.x
Mikami T, Tsuchihashi K, Kashiwagi M, Yachida Y, Daino T, Hashi K, Akino T, Gasa S.A sulfatide, O-fatty-acylated 3-sulfogalactosylceramide at C6-O on galactoside, was isolated from equine brain and the chemical structure was characterized by proton NMR and MS. The O-acylation site of the acylated sulfatide was determined by the down-field shift of protons attached to a carbon having an O-acyl group in the NMR spectrum and by analysis of a partially methylated derivative before and after acetalization of the intact sulfatide using GC-MS. The O-acyl chain length was determined by GLC, revealing that it exclusively had palmitoyl and stearoyl residues as the major fatty acids. T...
Cloning and chromosomal localization of MX1 and ETS2 to chromosome 26 of the horse (Equus caballus). Lear TL, Breen M, Ponce de Leon FA, Coogle L, Ferguson EM, Chambers TM, Bailey E.No abstract available
Fusion pore expansion in horse eosinophils is modulated by Ca2+ and protein kinase C via distinct mechanisms.
The EMBO journal    August 4, 1998   Volume 17, Issue 15 4340-4345 doi: 10.1093/emboj/17.15.4340
Scepek S, Coorssen JR, Lindau M.Using the patch-clamp technique, we studied the role of protein phosphorylation and dephosphorylation on the exocytotic fusion of secretory granules with the plasma membrane in horse eosinophils. Phorbol 12-myristate 13-acetate (PMA) had no effect on the amplitude and dynamics of degranulation, indicating that the formation of fusion pores is insensitive to activation of protein kinase C (PKC). Fusion pore expansion, however, was accelerated approximately 2-fold by PMA, and this effect was abolished by staurosporine. Elevating intracellular Ca2+ to 1.5 microM also resulted in a 2-fold accelera...
Detection of Ehrlichia risticii, the agent of Potomac horse fever, in freshwater stream snails (Pleuroceridae: Juga spp.) from northern California.
Applied and environmental microbiology    August 4, 1998   Volume 64, Issue 8 2888-2893 doi: 10.1128/AEM.64.8.2888-2893.1998
Barlough JE, Reubel GH, Madigan JE, Vredevoe LK, Miller PE, Rikihisa Y.Ehrlichia DNA was identified by nested PCR in operculate snails (Pleuroceridae: Juga spp.) collected from stream water in a northern California pasture in which Potomac horse fever (PHF) is enzootic. Sequencing of PCR-amplified DNA from a suite of genes (the 16S rRNA, groESL heat shock operon, 51-kDa major antigen genes) indicated that the source organism closely resembled Ehrlichia risticii, the causative agent of PHF. The minimum percentage of Juga spp. harboring the organism in the population studied was 3.5% (2 of 57 snails). No ehrlichia DNA was found in tissues of 123 lymnaeid, physid, a...
Equine dinucleotide repeat polymorphisms at loci ASB 21, 23, 25 and 37-43.
Animal genetics    July 31, 1998   Volume 29, Issue 1 67 
Irvin Z, Giffard J, Brandon R, Breen M, Bell K.No abstract available
Serologic response of horses to the structural proteins of equine arteritis virus. MacLachlan NJ, Balasuriya UB, Hedges JF, Schweidler TM, McCollum WH, Timoney PJ, Hullinger PJ, Patton JF.Equine arteritis virus (EAV) is the causative agent of equine viral arteritis, an apparently emerging disease of equids. In this study, the antibody response of horses to the structural proteins of EAV was evaluated using gradient-purified EAV virions and baculovirus-expressed recombinant EAV structural proteins (G(L), G(S), M, N) as antigens in a Western immunoblotting assay. Thirty-three sera from horses that previously had been naturally or experimentally infected with EAV were evaluated, including samples from mares, geldings, and both persistently and nonpersistently infected stallions. S...
Discrimination of mammalian growth hormones by peptide-mass mapping.
Rapid communications in mass spectrometry : RCM    July 31, 1998   Volume 12, Issue 14 975-981 doi: 10.1002/(SICI)1097-0231(19980731)12:14<975::AID-RCM263>3.0.CO;2-H
Laidler P, Cowan DA, Houghton E, Kicman AT, Marshall DE.Recognition by the legal authorities that growth hormones (GHs) may be abused to improve sporting performance and/or physique has led to the implementation of controls that make it an offence to produce, supply, possess or import and export GHs, with intent to supply, without the authority to do so. A method is described for the discriminatory analysis of human, equine, porcine and bovine GHs for forensic purposes. Peptide-mass mapping by matrix-assisted laser desorption/ionization (MALDI) time-of-flight (TOF) mass spectrometry following tryptic digestion gave sequence coverages of 97.4%, 93.7...
Construction of a horse BAC library and cytogenetical assignment of 20 type I and type II markers.
Mammalian genome : official journal of the International Mammalian Genome Society    July 29, 1998   Volume 9, Issue 8 633-637 doi: 10.1007/s003359900835
Godard S, Schibler L, Oustry A, Cribiu EP, Guérin G.A horse BAC library was constructed with about 40,000 clones and mean insert size of 110 kb representing a 1.5 genome equivalent coverage and a probability of finding a single sequence of 0.75. It was characterized by PCR screening of about 130 sequences of horse microsatellites and exonic gene sequences retrieved from databases. BACs containing 8 microsatellites and 12 genes were subsequently localized by fluorescent in situ hybridization (FISH) on chromosomes. Two linkage groups were newly assigned to chromosomes: LG2 to ECA3 and LG5 to ECA24, and five linkage groups were also oriented--LG3,...
Molecular basis for antigenic variation of a protective strain-specific antigen of Ehrlichia risticii.
Infection and immunity    July 23, 1998   Volume 66, Issue 8 3682-3688 doi: 10.1128/IAI.66.8.3682-3688.1998
Biswas B, Vemulapalli R, Dutta SK.Ehrlichia risticii, the causative agent of Potomac horse fever, has recently been isolated from many vaccinated horses with typical clinical signs of the disease. The heterogeneity of the E. risticii isolates obtained from the vaccinated horses necessitates the identification of the molecular basis of strain variations to elucidate the vaccine failure and to aid in the development of an efficient vaccine against this disease. As an attempt, two major cross-reacting surface antigen genes of 50- and 85-kDa antigens, present separately in strains 25-D (isolated in 1984) and 90-12 (isolated in 199...
Inhibition of glutathione S-transferase activity by the quinoid metabolites of equine estrogens.
Chemical research in toxicology    July 22, 1998   Volume 11, Issue 7 758-765 doi: 10.1021/tx9702190
Chang M, Zhang F, Shen L, Pauss N, Alam I, van Breemen RB, Blond SY, Bolton JL.The risk factors for women developing breast and endometrium cancers are all associated with a lifetime of estrogen exposure. Estrogen replacement therapy (ERT) in particular has been correlated with a slight increased cancer risk, although the numerous benefits of ERT may negate this harmful side effect. Equilenin and equilin are equine estrogens which make up between 30% and 45% of the most widely prescribed estrogen replacement formulation, Premarin (Wyeth-Ayerst). In this study we have synthesized the catechol metabolites of equilenin [4-hydroxyequilenin (4-OHEN)] and equilin [4-hydroxyequ...
Maturation-promoting factor (MPF) and mitogen activated protein kinase (MAPK) expression in relation to oocyte competence for in-vitro maturation in the mare.
Molecular human reproduction    July 17, 1998   Volume 4, Issue 6 563-570 doi: 10.1093/molehr/4.6.563
Goudet G, Belin F, Bézard J, Gérard N.In the equine species, a large proportion of oocytes fail to complete meiosis during in-vitro culture. The biochemical and molecular basis of this failure is unknown. The meiotic cell cycle is controlled in part by the maturation-promoting factor (MPF) and the mitogen-activated protein kinase (MAPK). In this study, we evaluated the oocyte competence for in-vitro maturation and the expression of MPF components (p34cdc2 and cyclin B) and MAPK after in-vitro culture. The maturation rate was influenced by the culture medium and the physiological stage of the mare at the time of oocyte recovery. We...
Redescription of Babesia equi Laveran, 1901 as Theileria equi Mehlhorn, Schein 1998.
Parasitology research    July 11, 1998   Volume 84, Issue 6 467-475 doi: 10.1007/s004360050431
Mehlhorn H, Schein E.The horse-parasitizing species Babesia equi Laveran, 1901 was redescribed as Theileria equi Mehlhorn, Schein 1998 and, thus, transferred from one valid genus to another. This transfer was needed since it turned out that this horse parasite showed the relevant characteristics of theilerians with regard to biological data, morphological features, biochemical properties, and molecular biological relationships.
Determination of the volume changes for pressure-induced transitions of apomyoglobin between the native, molten globule, and unfolded states.
Biophysical journal    July 2, 1998   Volume 75, Issue 1 463-470 doi: 10.1016/S0006-3495(98)77534-4
Vidugiris GJ, Royer CA.The volume change for the transition from the native state of horse heart apomyoglobin to a pressure-induced intermediate with fluorescence properties similar to those of the well-established molten globule or I form was measured to be -70 ml/mol. Complete unfolding of the protein by pressure at pH 4.2 revealed an upper limit for the unfolding of the intermediate of -61 ml/mol. At 0.3 M guanidine hydrochloride, the entire transition from native to molten globule to unfolded state was observed in the available pressure range below 2.5 kbar. The volume change for the N-->I transition is relat...
Detection of virulent Rhodococcus equi in tracheal aspirate samples by polymerase chain reaction for rapid diagnosis of R. equi pneumonia in foals.
Veterinary microbiology    July 1, 1998   Volume 61, Issue 1-2 59-69 doi: 10.1016/s0378-1135(98)00163-1
Takai S, Vigo G, Ikushima H, Higuchi T, Hagiwara S, Hashikura S, Sasaki Y, Tsubaki S, Anzai T, Kamada M.Polymerase chain reaction (PCR)-based assays were developed to detect virulent Rhodococcus equi in transtracheal aspirate samples from sick foals showing respiratory signs. An oligonucleotide primer pair from the sequence of the virulence-associated 15- to 17-kDa antigen gene of the virulence plasmid in virulent R. equi was used to amplify a 564 bp region by PCR, and the result was confirmed by Southern blot hybridization. No positive reaction was seen in DNA from 13 different microorganisms typically found in the respiratory tract. In tracheal aspirates seeded with virulent R. equi, a visible...
Molecular analysis of the virulence determinants of Clostridium perfringens associated with foal diarrhoea.
Veterinary journal (London, England : 1997)    June 25, 1998   Volume 155, Issue 3 289-294 doi: 10.1016/s1090-0233(05)80025-5
Netherwood T, Wood JL, Mumford JA, Chanter N.During an epidemiological study of foal diarrhoea, over half of the cases yielded Clostridium perfringens which was significantly associated with disease (Netherwood et al., 1996b). However, the association could not be accounted for by enterotoxigenic isolates which had a low prevalence (Netherwood et al., 1997). Nonetheless, we have hypothesized that the association may be caused by a pathogenic sub-population which would be significantly more common amongst C. perfringens-positive cases compared with C. perfringens-positive healthy controls if it acted as a pathogen when present. Conversely...
Multiple kinetic intermediates accumulate during the unfolding of horse cytochrome c in the oxidized state.
Biochemistry    June 24, 1998   Volume 37, Issue 25 9147-9155 doi: 10.1021/bi980470u
Bhuyan AK, Udgaonkar JB.The unfolding kinetics of horse cytochrome c in the oxidized state has been studied at 10, 22, and 34 degreesC as a function of guanidine hydrochloride (GdnHCl) concentration. Rapid (millisecond) measurements of far-UV circular dichroism (CD) as well as fluorescence quenching due to tryptophan to heme excitation energy transfer have been used to monitor the unfolding process. At 10 degreesC, the decrease in far-UV CD signal that accompanies unfolding occurs in two phases. The unobservable burst phase is complete within 4 ms, while the slower phase occurs over tens to hundreds of milliseconds. ...