Analyze Diet

Topic:Species Comparison

Species comparison in horses involves examining the physiological, anatomical, and behavioral differences and similarities between horses and other animal species. This area of study can provide insights into the evolutionary adaptations and ecological roles of horses. Researchers often focus on aspects such as digestive systems, locomotion, sensory capabilities, and social structures to understand how horses have evolved to meet their environmental and survival needs. Comparative studies may also explore genetic differences and similarities, contributing to a broader understanding of species evolution and adaptation. This page aggregates peer-reviewed research and scholarly articles that analyze various aspects of species comparison involving horses, highlighting significant findings and methodologies used in the field.
[Differentiation of domestic horse and Przewalskis horse using various DNA sequences].
Genetika    September 28, 1998   Volume 34, Issue 7 996-999 
Glazko VI, Zelenaia LB.The electrophoretic mobility of seven erythrocyte enzymes and spectra of fragments amplified by RAPD-PCR with primers UBC-85 and UBC-126 were comparatively analyzed in domestic horse and Przewalski's horse. All tested genetic markers were classified into two groups differing in their involvement in differentiation of the two closely related horse species. Markers from different groups differed neither in their type (a polymorphic protein or an amplification product) nor in their biochemical role (for enzymes).
[Are zoo Przewalski horses domesticated horses?].
Berliner und Munchener tierarztliche Wochenschrift    September 19, 1998   Volume 111, Issue 7-8 273-280 
Röhrs M, Ebinger P.Analysed were the brain case capacities and brain weights of wild przewalski horses, przewalski horses from zoological gardens and domesticated horses. Domesticated horses have about 14% less brain case capacity and 16% less brain weight than wild przewalski horses. Przewalski horses from zoological gardens also have about 14% less brain capacity than wild przewalski horses. The brain weight of przewalski horses from zoological gardens shows no difference to the brain weight of domesticated horses. If we look at the brain size, przewalski horses from zoological gardens are domesticated horses....
Controlled-release products for the control of the estrus cycle in cattle, sheep, goats, deer, pigs, and horses.
Critical reviews in therapeutic drug carrier systems    September 15, 1998   Volume 15, Issue 4 285-379 
Rathbone MJ, Macmillan KL, Jöchle W, Boland MP, Inskeep EK.This paper describes the estrus cycles of a number of livestock breeds and reviews the controlled-release drug delivery systems that are currently available for the purpose of controlled breeding. The bovine estrus cycle is reviewed in detail, and the estrus cycles of other species are described in a manner that highlights similarities and differences between species. Pertinent formulation and pharmacokinetic information about current drug delivery systems is presented and discussed, and recent advances in this area are also described.
Effect of density and weight of load on the energy cost of carrying loads by donkeys and ponies.
Tropical animal health and production    August 28, 1998   Volume 30, Issue 1 67-78 doi: 10.1023/a:1005021729061
Pearson RA, Dijkman JT, Krecek RC, Wright P.Two experiments were designed to compare the energy used in carrying loads by donkeys and ponies. In the first experiment 3 donkeys and 3 ponies were compared on treadmills in the UK. Density of load (lead shot or straw) had no significant effect on the energy cost of carrying loads; however, the energy cost of carrying a load decreased significantly (p < 0.001) as the weight of the load increased (in donkeys 6.44, 4.35 and 3.03 J/kg load/m, in ponies 5.82, 3.75 and 3.68 J/kg load/m, for loads of 13, 20 and 27 kg/100 kg liveweight (M) respectively). Differences between species were not sign...
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
A comparative study of mast cells and eosinophil leukocytes in the mammalian testis.
Zentralblatt fur Veterinarmedizin. Reihe A    August 11, 1998   Volume 45, Issue 4 209-218 doi: 10.1111/j.1439-0442.1998.tb00819.x
Anton F, Morales C, Aguilar R, Bellido C, Aguilar E, Gaytán F.The existence of a physiological integration between the immune and endocrine systems has long been recognized. In spite of the abundant literature data on the presence of cells of the immune system in the testis, mast cells and eosinophil leukocytes have received little attention. We have studied the presence, distribution and numbers of mast cells and eosinophils in the testes of 12 mammalian species. Mast cells were frequently found in equine (stallion, ass and mule) and human testis, whereas eosinophils were nearly absent. On the contrary, eosinophils were abundant in the hare testis, whil...
Pharmacokinetics of sulfonamides and trimethoprim in the donkey (Equus asinus).
Zentralblatt fur Veterinarmedizin. Reihe A    August 11, 1998   Volume 45, Issue 4 191-198 doi: 10.1111/j.1439-0442.1998.tb00817.x
Oukessou M, Alsouss L.The body disposition of sulfadimidine (SDM), sulfadiazine (SDZ), sulfamethoxypyridazine (SMPZ) and a trimethoprim-sulfadimethoxine combination (TMP-SDMX) was investigated in the donkey. The four sulfonamides and TMP were injected intravenously at doses of 20 mg/kg (SDM, SDZ, SMPZ), 12.5 mg/kg (SDMX) and 2.5 mg/kg (TMP). The body clearance (ClB) of SDZ (1.70 +/- 0.14 ml/min/kg) was significantly higher than those of SDM (1.13 +/- 0.18 ml/min/kg), SMPZ (1.10 +/- 0.09 ml/min/kg) and SDMX (0.75 +/- 0.04 ml/min/kg). In contrast, the volume of distribution at steady state (Vss) was similar for the f...
Cloning and chromosomal localization of MX1 and ETS2 to chromosome 26 of the horse (Equus caballus). Lear TL, Breen M, Ponce de Leon FA, Coogle L, Ferguson EM, Chambers TM, Bailey E.No abstract available
Ageing Arab horses by their dentition.
The Veterinary record    July 22, 1998   Volume 142, Issue 24 659-662 doi: 10.1136/vr.142.24.659
Muylle S, Simoens P, Lauwers H, Van Loon G.The dentition of 170 Arab horses of known ages was examined and compared with the dental characteristics of trotter horses and Belgian draft horses of the same ages. The results indicated that inaccuracies in the determination of the age of horses by their dentition may result, at least partly, from differences between the breeds of horse involved because there were some major differences between the three breeds examined. These differences increased as the horses' true age increased. In general, the rate of dental wear was slower in the Arab horses than in trotter horses and Belgian draft hor...
The activity of mixed function oxidases, estimated by in vivo antipyrine clearance, is similar in horses and camels.
Comparative biochemistry and physiology. Part C, Pharmacology, toxicology & endocrinology    July 21, 1998   Volume 119, Issue 2 139-142 doi: 10.1016/s0742-8413(97)00200-4
Wasfi IA, Zorob OM, Boni NS, Hadi AA, Agha BA, Elghazali M.The activity of hepatic mixed function oxidases was compared in horses and camels (Camelus dromedarius) by studying the pharmacokinetics of antipyrine in seven camels and five horses following intravenous administration of a single dose of antipyrine (25 mg/kg). The data obtained (mean +/- SEM and median in brackets) in camels and horses, respectively, were as follows: the elimination half-lives were 3.25 +/- 0.23 (3.19) and 3.09 +/- 0.25 (2.90) hr; the apparent volumes of distribution (area method) were 0.691 +/- 0.045 (0.648) and 0.642 +/- 0.034 (0.676) l/kg; the volumes of distribution at s...
Occurrence and importance of glomus organs (Hoyer-Grosser’s organs) in the skin of the equine and bovine mammary gland.
Anatomia, histologia, embryologia    July 4, 1998   Volume 27, Issue 3 155-159 doi: 10.1111/j.1439-0264.1998.tb00173.x
Ludewig T.Glomus organs (Hoyer-Grosser's organs) were frequently found in the corium and the subcutis of the skin of the equine and bovine mammary gland. They were most frequently situated in the border zone between the stratum profundum and the stratum superficiale corii. These specialized vascular structures (arterio-venous anastomosis) were present in all investigated skin areas. Although the glomus organs varied in size and shape, they possessed common histologic structures: an arteriole entered the connective capsule of the glomus and divided into strongly convoluted arterio-venous channels; the ar...
The interaction of Streptococcus dysgalactiae with plasmin and plasminogen.
Veterinary microbiology    July 1, 1998   Volume 61, Issue 1-2 121-135 doi: 10.1016/s0378-1135(98)00179-5
Leigh JA, Hodgkinson SM, Lincoln RA.The activation of plasminogen and the binding of plasmin by bacteria may have many effects which promote infection. The occurrence of such activities in streptococci is well documented; however, these are yet to be demonstrated for S. dysgalactiae. Consequently, the ability of this bacterium to activate mammalian plasminogen and bind either plasmin or its zymogen was investigated. Activation of bovine plasminogen was dependent on both the strain and the growth medium used for cultivation. Eighteen strain were able to activate bovine and ovine plasminogen and some of these also activated plasmi...
Polymorphism and multiple loci for the horse DQA gene.
Immunogenetics    June 20, 1998   Volume 47, Issue 6 487-490 doi: 10.1007/s002510050387
Fraser DG, Bailey E.No abstract available
Structure-function relationships for equine and human aromatases. A comparative study.
Annals of the New York Academy of Sciences    June 18, 1998   Volume 839 576-577 doi: 10.1111/j.1749-6632.1998.tb10879.x
Moslemi S, Auvray P, Sourdaine P, Drosdowsky MA, Seralini GE.No abstract available
[Equine Cushing syndrome (ECS). Case report, review of its diagnosis and therapy and substantial differences from Cushing syndrome in dogs].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    June 17, 1998   Volume 26, Issue 1 41-47 
Fey K, Jonigkeit E, Moritz A.Equine and canine Cushing's syndrome, both of which are the result of elevated cortisol levels, show some different pathogenetical and clinical features and require different therapeutical approaches. In older horses the equine Cushing's syndrome (ECS) is not uncommon. Nearly all cases result from excessive hormone production in cells of the pars intermedia of the pituitary. Besides elevated levels of adrenocorticotrope hormone (ACTH), high peripheral levels of pro-opiomelanocortin, beta-endorphines and alpha-melanocyte-stimulating hormone can be measured. In middle-aged and geriatric dogs, Cu...
Close relationship between equine and human molluscum contagiosum virus demonstrated by in situ hybridisation.
Research in veterinary science    June 13, 1998   Volume 64, Issue 2 157-161 doi: 10.1016/s0034-5288(98)90012-1
Thompson CH, Yager JA, Van Rensburg IB.To determine whether the virus responsible for human molluscum contagiosum (MCV) is the causal agent of a similar disease in horses, in situ hybridisations using cloned fragments of human MCV DNA labelled with digoxigenin were carried out on formalin-fixed biopsy sections of lesions from two horses with molluscum contagiosum-like skin lesions. In both instances there was evidence of specific hybridisation of the labelled probe to target DNA in the sections under high stringency conditions, identified by the development of a deep blue-purple stain in the cytoplasm of cells in the stratum spinos...
A dinucleotide mutation in the endothelin-B receptor gene is associated with lethal white foal syndrome (LWFS); a horse variant of Hirschsprung disease.
Human molecular genetics    June 13, 1998   Volume 7, Issue 6 1047-1052 doi: 10.1093/hmg/7.6.1047
Yang GC, Croaker D, Zhang AL, Manglick P, Cartmill T, Cass D.Lethal white foal syndrome (LWFS) is a congenital anomaly of horses characterized by a white coat colour and aganglionosis of the bowel, which is similar to Hirschsprung disease (HSCR). We decided to investigate possible mutations of the endothelin-B receptor gene ( EDNRB ) in LWFS as recent studies in mutant rodents and some patients have demonstrated EDNRB defects. First, we identified a full-length cDNA for horse EDNRB . This cDNA fragment contained a 1329 bp open reading frame which encoded 443 amino acid residues. The predicted amino acid sequence was 89, 91 and 85% identical to human, bo...
Skeletal muscle glycolytic capacity and phosphofructokinase regulation in horses with polysaccharide storage myopathy.
American journal of veterinary research    June 12, 1998   Volume 59, Issue 6 782-785 
Valberg SJ, Townsend D, Mickelson JR.To determine whether polysaccharide storage myopathy (PSSM) in Quarter Horses is attributable to a defect in glycolysis or in the allosteric regulation of phosphofructokinase (PFK) enzyme. Methods: Muscle biopsy specimens were obtained from 6 Quarter Horses with PSSM and 8 Quarter Horse or Thoroughbred control horses. Methods: Maximal activity of glycogenolytic and glycolytic enzymes was determined spectrophotometrically. Maximal activity of PFK was determined for each horse at pH 8.0, and at pH 7.0 when variable concentrations of the activators, fructose 6 phosphate, fructose 2,6 bisphosphate...
Objectivity of two methods of differentiating fibre types and repeatability of measurements by application of the TEMA image analysis system.
European journal of histochemistry : EJH    June 6, 1998   Volume 42, Issue 1 49-62 
Henckel P, Ducro B, Oksbjerg N, Hassing L.The objectivity of two of the most widely used methods for differentiation of fibre types, i.e. 1) the myosin ATP-ase method (Brooke and Kaiser, 1970a,b) and 2) the combined method, by which the myosin ATP-ase reaction is used to differentiate between fast and slow twitch fibres and NADH-tetrazolium reductase activity is used to identify the subgroups of fast twitch fibres (Ashmore and Doerr, 1970, Peter et al., 1972), was assessed in muscle samples from horses, calves and pigs. We also assessed the objectivity of the alpha-amylase-PAS preparation for the visualisation of capillaries (Andersen...
A conserved structural element in horse and mouse IGF2 genes binds a methylation sensitive factor.
Nucleic acids research    May 30, 1998   Volume 26, Issue 7 1605-1612 doi: 10.1093/nar/26.7.1605
Otte K, Choudhury D, Charalambous M, Engström W, Rozell B.The equine IGF2 gene has been cloned and characterised. It spans a 9 kb region, which is substantially less than the corresponding human gene. Three coding exons and three untranslated leader exons, all highly homologous to those in other species, were identified. Downstream of the polyadenylation site in exon 6, a dinucleotide repeat sequence was identified. Three putative promoters (P1-P3) were localised in the 5' region of the gene. RNase protection analysis revealed two active promoters in fetal tissues, P2 and P3, whereas P3 was the only promoter active in adult tissues. This represents a...
Peculiarities of vitamin D and of the calcium and phosphate homeostatic system in horses.
Veterinary research    May 28, 1998   Volume 29, Issue 2 173-186 
Breidenbach A, Schlumbohm C, Harmeyer J.The aim of the present study was to investigate the importance of putative regulatory factors of the calcium (Ca) and inorganic phosphate (P(i)) homeostatic system in the horse. The concentrations of Ca, P(i), vitamin D metabolites, parathyroid hormone (PTH), the activity of the alkaline phosphatase (AP) and the concentration and binding properties of vitamin D binding protein (DBP) were measured in the plasma. In addition, the ability of the renal cortex to hydroxylate calcidiol into 24,25(OH)2D3 and 1,25(OH)2D3 was evaluated in vitro. The plasma concentration of Ca (3.2 +/- 0.15 mmol.L-1, N ...
An aspartic proteinase expressed in the equine placenta.
Advances in experimental medicine and biology    April 30, 1998   Volume 436 163-167 doi: 10.1007/978-1-4615-5373-1_22
Green J, Xie S, Gan X, Roberts RM.This manuscript describes the cloning of a novel aspartic proteinase expressed in the placenta of the horse (order Perrisodactyla). Evidence for similar genes in the cat (Carnivora) and ruminants (Artiodactyla), indicates that these molecules have been conserved within widely divergent species with distinct types of placentation. Since ePAG is produced by the outer cell layer (trophoblast) of the placenta, it can tentatively be grouped with the pregnancy-associated glycoproteins (PAG) of cattle, sheep, and pig. The high sequence identity that ePAG shares with pepsinogens as well as the PAG, in...
Characterization of a microsatellite in the promoter region of the IGF1 gene in domestic horses and other equids.
Genome    April 29, 1998   Volume 41, Issue 1 70-73 
Caetano AR, Bowling AT.Insulin-like growth factor 1 (IGF1) regulates growth and metabolic functions in vertebrates. A dinucleotide repeat sequence located at the promoter region of the IGF1 gene has been reported in several vertebrate species and may affect the control of the transcriptional activity of this gene. The genotypes of animals from seven horse breeds were determined in order to study the potential association of allelic forms of this microsatellite with adult body size differences found in domestic horses. Among these breeds, five alleles were found. Breed-specific differences in adult body size could no...
Free amino acids in milks of human subjects, other primates and non-primates.
The British journal of nutrition    April 16, 1998   Volume 79, Issue 2 129-131 doi: 10.1079/bjn19980023
Sarwar G, Botting HG, Davis TA, Darling P, Pencharz PB.Preterm and term transitional milks of human subjects and mature milks of human subjects, non-human primates and non-primates were analysed for free amino acids (AA) using precolumn phenylisothiocyanate derivatization and liquid chromatography. Differences in free AA between three types of human milk were small. Milks of pinnipeds (seals and sea lions) contained the highest levels of total free AA (8634-20,862 mumol/l), while the milks of cows and sheep had the lowest levels of total free AA (1061-1357 mumol/l). The milks of human subjects, chimpanzees (Pan troglodytes), gorillas (Gorilla gori...
Comparative immunohistochemical study of stellate cells in normal canine and equine adenohypophyses and in pituitary tumours.
Journal of comparative pathology    March 21, 1998   Volume 118, Issue 1 29-40 doi: 10.1016/s0021-9975(98)80025-x
Méndez A, Martín de las Mulas J, Bautista MJ, Chacón F, Millán Y, Fondevila D, Pumarola M.The presence and distribution of S100 protein (alpha and beta subunits), cytokeratin polypeptides, glial fibrillary acidic protein, neurofilaments, vimentin, neuron specific enolase, synaptophysin, HLA class II DR antigen, and pituitary hormones (prolactin, adrenocorticotropic hormone and human chorionic gonadotrophin) in stellate cells were studied immunohistochemically in four normal canine pituitary glands, five canine pituitary adenomas, two canine pituitary carcinomas and two equine pituitary adenomas (with surrounding normal glandular tissue). Stellate cells of the pars distalis and pars...
Inhibition and inactivation of equine aromatase by steroidal and non-steroidal compounds. A comparison with human aromatase inhibition.
Journal of enzyme inhibition    March 21, 1998   Volume 12, Issue 4 241-254 doi: 10.3109/14756369709035817
Moslemi S, Seralini GE.In order to approach the detailed structure-function relationships of aromatase, we studied the inhibitory and inactivatory potencies of several steroidal androstenedione analogues (1: 4-hydroxyandrostenedione, 2: 4-acetoxyandrostenedione and 3: 7 alpha-(4'-amino)phenylthio-4-androstene-3, 17-dione) and non-steroidal imidazole derivatives (4: ketoconazole, 5: miconazole and 6: fadrozole) on equine aromatase in placental microsomes, a well established mammalian model. Human placental microsomes and the purified enzyme from equine testis were also used to compare inhibition by 1 and 2. In equine...
Equus caballus gelsolin–cDNA sequence and protein structural implications.
European journal of biochemistry    March 7, 1998   Volume 251, Issue 3 613-621 doi: 10.1046/j.1432-1327.1998.2510613.x
Koepf EK, Hewitt J, Vo H, Macgillivray RT, Burtnick LD.We have generated and characterized the cDNA from equine smooth muscle that encodes gelsolin, an actin-modulating protein. Overlapping cDNA clones synthesized by the reverse transcriptase/polymerase chain reaction and clones isolated from a horse genomic library provided the complete primary structure for the intracellular isoform of gelsolin, while cDNA complemented with protein sequence data produced the full-length primary transcript of the gelsolin isoform found circulating in equine plasma. The deduced amino acid sequences of the intracellular and secreted versions of equine gelsolin infe...
The pathophysiology of osteochondrosis.
The Veterinary clinics of North America. Small animal practice    February 17, 1998   Volume 28, Issue 1 17-32 doi: 10.1016/s0195-5616(98)50002-2
Ekman S, Carlson CS.Osteochondrosis is a disorder of epiphyseal cartilage about which there is considerable confusion in the literature. We believe that this is due to the fact that osteochondrosis has been studied in the chronic stage when the lesions are morphologically complicated and the initial causative insult is impossible to determine. The etiology of osteochondrosis appears to be multifactorial, with trauma, hereditary factors and rapid growth, nutritional factors, and ischemia all having a role in its pathogenesis. Although predilection sites are variable among species, the morphology of the early lesio...
Biomechanical implications of mineral content and microstructural variations in cortical bone of horse, elk, and sheep calcanei.
The Anatomical record    February 12, 1998   Volume 249, Issue 3 297-316 doi: 10.1002/(SICI)1097-0185(199711)249:3<297::AID-AR1>3.0.CO;2-S
Skedros JG, Su SC, Bloebaum RD.Artiodactyl and perissodactyl calcanei have been recently introduced as models for examining bone for mechanically mediated adaptation. We have reported substantial regional variations in cortical bone microstructure and mineral content within the same cross-section of mule deer calcanei. In part, these variations may be adaptations accommodating the customary presence of predominantly tension, compression, and shear strain modes in mutually exclusive cortical locations. Calcanei from skeletally mature horses, elk, and sheep were examined in order to corroborate these previous findings. From e...
Molecular cloning and cartilage gene expression of equine stromelysin 1 (matrix metalloproteinase 3).
American journal of veterinary research    January 27, 1998   Volume 59, Issue 1 30-36 
Balkman CE, Nixon AJ.To clone and determine molecular structure of equine stromelysin 1 (matrix metalloproteinase 3) and examine stromelysin expression in articular cartilage. SAMPLES AND PROCEDURE: Total RNA was harvested from equine arthritic cartilage specimens and was used for reverse transcription and polymerase chain reaction amplification to develop overlapping complementary DNA (cDNA) clones. Four cDNA sequences were ligated into plasmid (pGEM3Z) constructs and subcloned into bacterial expression vectors, and sequence was determined by automated dye terminator sequencing. Stromelysin mRNA expression was as...
1 58 59 60 61 62 98