Analyze Diet

Topic:Endocrine System

The endocrine system in horses comprises a network of glands and hormones that regulate various physiological processes, including metabolism, growth, reproduction, and stress response. Key components of the equine endocrine system include the pituitary gland, thyroid gland, adrenal glands, and pancreas. Hormones such as insulin, cortisol, and thyroid hormones are produced and released into the bloodstream to maintain homeostasis and respond to internal and external stimuli. Dysregulation of the endocrine system can lead to conditions such as Equine Cushing's Disease (Pituitary Pars Intermedia Dysfunction) and Equine Metabolic Syndrome. This page compiles peer-reviewed research studies and scholarly articles that explore the structure, function, and disorders of the endocrine system in horses, providing insights into its impact on equine health and management.
Nortestosterone: endogenous in urine of goats, sheep and mares?
The Analyst    August 6, 1999   Volume 123, Issue 12 2633-2636 doi: 10.1039/a804947e
Sterk S, Herbold H, Blokland M, van Rossum H, van Ginkel L, Stephany R.For a number of species it is known that nortestosterone, either the alpha- or beta-epimer, can be of endogenous origin. For goats and mares similar results have not yet been published. As a follow-up on the experiments with cattle, a large number of urine samples per animal were collected from pregnant goats, sheep and mares. These samples were analysed for the presence of alpha- and beta-nortestosterone and alpha-estradiol using GC-MS. The results show that in the goats and mares studied alpha-nortestosterone is present during pregnancy. In this study no alpha-nortestosterone could be demons...
Effects of anabolic steroid (19-nortestosterone) on the secretion of testicular hormones in the stallion.
Journal of reproduction and fertility    August 6, 1999   Volume 115, Issue 2 373-379 doi: 10.1530/jrf.0.1150373
Nagata S, Kurosawa M, Mima K, Nambo Y, Fujii Y, Watanabe G, Taya K.The aim of this study was to clarify the effect of anabolic steroids on the testicular endocrine function of mature stallions. Mature thoroughbred stallions were treated with 800 mg nandrolone decanoate every 3 weeks for 3 months. After the first treatment, plasma concentrations of LH, immunoreactive inhibin and testosterone decreased rapidly to the nadir. These hormones were maintained at significantly lower concentrations compared with concentrations in intact stallions. Histology of the testicular tissue indicated the arrest of advanced spermatogenesis in the seminiferous tubules and a seve...
Serum cortisol concentrations in response to incremental doses of inhaled beclomethasone dipropionate.
Equine veterinary journal    July 13, 1999   Volume 31, Issue 3 258-261 doi: 10.1111/j.2042-3306.1999.tb03183.x
Rush BR, Trevino IC, Matson CJ, Hakala JE.No abstract available
[Diagnosis, therapy and endocrinologic parameters of persistent follicles in mares in comparison with preovulatory follicles].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    June 29, 1999   Volume 27, Issue 3 180-186 
Kaiser B, Koene M, Swagemakers J, Bader H, Hoppen HO.During the 1997 breeding season persistent follicles were diagnosed in 17 mares. In 16 of these mares a total of 17 follicles were transabdominally punctured and the steroids oestradiol, progesterone and testosterone were measured in the follicular fluid and in blood serum. In ten mares serving as a control group preovulatory follicles were punctured. The follicular fluid of the persistent follicles revealed a very high variability of the steroid concentrations. Depending on the steroid ratio within the follicles, eight follicles were rated as being intact, three follicles were undergoing atre...
Follicle deviation and intrafollicular and systemic estradiol concentrations in mares.
Biology of reproduction    June 22, 1999   Volume 61, Issue 1 31-39 doi: 10.1095/biolreprod61.1.31
Gastal EL, Gastal MO, Wiltbank MC, Ginther OJ.By definition, follicle deviation begins on the day the two largest follicles of a wave begin to differ in growth rates. The relationships between follicle deviation and intrafollicular and systemic estradiol concentrations were studied in ponies, using a two-follicle model in which all but the two largest follicles were ablated. A 20-microliter sample of follicular fluid was obtained from each of the two follicles by transvaginal ultrasonography. In experiment 1, the two follicles were sampled when the larger follicle reached 15 mm. No differences (p > 0.05) in post-sampling follicle chara...
The effects of intrafetal ACTH administration on the outcome of pregnancy in the mare.
Reproduction, fertility, and development    June 4, 1999   Volume 10, Issue 4 359-367 doi: 10.1071/r98045
Ousey JC, Rossdale PD, Dudan FE, Fowden AL.Enhanced adrenocortical activity in the fetus is related to the onset of parturition in many species. The aim of this study was to determine the effect of injection of fetal ACTH on gestational length and fetal viability in the horse. Pony mares (n=23) were studied from 300 days gestation. Seven control mares (Group 1) received three consecutive intrafetal injections of sterile water, while fetuses of a further 16 mares received Depot ACTH1-24. These mares were either allowed to foal spontaneously (Group 2, n=4) or delivery was induced within 3 days of the last fetal injection (Group 3, n=7); ...
Effects of hypoxia on endocrine and metabolic responses to anaesthesia in ponies.
Research in veterinary science    March 24, 1999   Volume 66, Issue 1 39-44 doi: 10.1053/rvsc.1998.0236
Taylor PM.Some metabolic and endocrine effects of hypoxaemia were studied during halothane anaesthesia in six ponies. Each was anaesthetised twice; on one occasion a 20-minute period of hypoxaemia (arterial oxygen tension between 4.4 and 5.8 [mean 5.3] kPa) was imposed during 120 minutes of anaesthesia. On the second occasion arterial oxygen tension was maintained above 17 kPa throughout. Routine cardiovascular monitoring was performed and blood samples were taken to measure haematocrit, cortisol, insulin, glucose and lactate. Anaesthesia was associated with hypotension in both groups (mean ABP 7.0 kPa...
Endocrine and metabolic responses to plasma volume expansion during halothane anesthesia in ponies.
Journal of veterinary pharmacology and therapeutics    January 14, 1999   Volume 21, Issue 6 485-490 doi: 10.1046/j.1365-2885.1998.00169.x
Taylor PM.The study was designed to contribute to identification of the stimulus to adrenocortical activity during halothane anaesthesia in equidae. Two groups of six ponies were premedicated with acepromazine before induction of anaesthesia with thiopentone and maintenance for 120 min with halothane in oxygen. In group H Haemaccel modified gelatine plasma replacer was infused (48+/-13 mL/kg) to maintain mean arterial blood pressure (MABP) close to preanaesthetic values. In group DH, blood pressure was maintained close to preanaesthetic levels with a lower dose of Haemaccel (10 mL/kg) combined with an i...
Gonadotrophin profiles and dioestrous pulsatile release patterns in mares as determined by collection of jugular blood at 4 h intervals throughout an oestrous cycle.
Journal of reproduction and fertility    December 23, 1998   Volume 113, Issue 2 315-322 doi: 10.1530/jrf.0.1130315
Irvine CH, Turner JE, Alexander SL, Shand N, van Noordt S.In mares, dioestrous FSH profiles based on once-a-day sampling are variable; however, the pulsatility of plasma FSH, which has been suggested by limited windows of intensive sampling, may contribute to this variability. Jugular blood from six mares was sampled at 4 h intervals throughout an ovulatory cycle to determine cyclic FSH and LH patterns more accurately and to measure gonadotrophin pulse frequency during dioestrus. Synchronous pulses of FSH and LH occurred regularly in all mares between day 4 and day 12 (ovulation = day 0) with a mean (+/- SEM) frequency of 1.9 +/- 0.1 (FSH) or 1.6 +/-...
Endometrial oxytocin receptor and uterine prostaglandin secretion in mares during the oestrous cycle and early pregnancy.
Journal of reproduction and fertility    December 23, 1998   Volume 113, Issue 2 173-179 doi: 10.1530/jrf.0.1130173
Starbuck GR, Stout TA, Lamming GE, Allen WR, Flint AP.Circulating concentrations of 13,14-dihydro-15-ketoprostaglandin F2 alpha (PGFM) were measured before and after administration of oxytocin and after endometrial biopsy, with or without uterine flushing performed per vaginam, on days 10, 14 and 18 after ovulation in nine pregnant and nine cyclic mares. Concentrations of oxytocin receptor were measured in endometrial biopsy samples. Neither pregnancy status nor time after ovulation affected basal PGFM concentrations. PGFM concentrations were increased after oxytocin administration on each of the days studied in cyclic mares; on day 14 the mean r...
The effect of dietary protein on reproduction in the mare. V. Endocrine changes and conception during the early post partum period.
Journal of the South African Veterinary Association    December 16, 1998   Volume 69, Issue 3 81-88 doi: 10.4102/jsava.v69i3.822
van Niekerk FE, van Niekerk CH.Pregnant Anglo-Arab and Thoroughbred mares (n = 24) were divided randomly according to age and breed into 4 groups of 6 mares each from approximately 6 weeks before their expected foaling date. Diets received by the 4 groups varied in essential amino-acid and total protein contents. Serum progestagen, FSH and LH concentrations were determined from the day of parturition until foal heat and during the 1st oestrous cycle following foal heat. Serum progestagen, FSH and LH concentrations did not differ between the treatment groups. Progestagen concentrations were high (mean = 7.0: 5.2-16.4 ng/ml) ...
Gonadotropin response to naloxone in the mare: effect of time of year and reproductive status.
Biology of reproduction    October 22, 1998   Volume 59, Issue 5 1195-1199 doi: 10.1095/biolreprod59.5.1195
Davison LA, McManus CJ, Fitzgerald BP.In the mare, endogenous opioids have been implicated in the suppression of gonadotropin secretion during seasonal anestrus (AN). The present study tested whether continuation of reproductive activity during the nonbreeding season (NBS) reflects the absence of a seasonal shift in opioid tone compared to what occurs in AN mares. During the NBS, 11 AN and 8 luteal-phase mares received 0.1, 0.05, 0. 025 mg/kg naloxone (NAL) or vehicle on alternate days. Whereas cycling mares responded to all dosages of NAL, AN mares responded only to the higher dosages for FSH, and LH failed to increase at any dos...
Equine chorionic gonadotropin regulates luteal steroidogenesis in pregnant mares.
Biology of reproduction    October 22, 1998   Volume 59, Issue 5 1062-1068 doi: 10.1095/biolreprod59.5.1062
Daels PF, Albrecht BA, Mohammed HO.The onset of eCG secretion in pregnant mares coincides with an increase in luteal steroid production and a relative shift toward androgen and estrogen synthesis. However, a cause-effect relationship between eCG and the shift in luteal steroidogenesis has not been demonstrated. In this study, we have investigated the effect of eCG on steroid production by the corpus luteum (CL) during equine pregnancy. All mares were supplemented with 44 mg altrenogest (a progestogen) per day on Days 18-50. Increasing doses of eCG were administered on Days 26-28, before the onset of endogenous eCG secretion, to...
Effects of hypercapnia on endocrine and metabolic responses to anaesthesia in ponies.
Research in veterinary science    October 13, 1998   Volume 65, Issue 1 41-46 doi: 10.1016/s0034-5288(98)90025-x
Taylor PM.Some metabolic and endocrine effects of hypercapnia were studied in six ponies during halothane anaesthesia with neuromuscular blockade and controlled ventilation. Each was anaesthetised twice, once with a 40-minute-period of hypercapnia (10 kPa) and once when normocapnia (5.3 kPa) was maintained throughout two hour's anaesthesia. Routine cardiovascular monitoring was performed and blood samples were taken for assay of cortisol, insulin, glucose, lactate, muscle and liver enzymes and total protein. Anaesthesia induced hypotension and lacticacidaemia which were slightly ameliorated during hyper...
Adrenocortical and metabolic responses to dobutamine infusion during halothane anaesthesia in ponies.
Journal of veterinary pharmacology and therapeutics    September 10, 1998   Volume 21, Issue 4 282-287 doi: 10.1046/j.1365-2885.1998.00130.x
Taylor PM.The study investigated whether hypotension in halothane-anaesthetised ponies is the stimulus inducing an endocrine stress response by assessing the effect of maintenance of normotension with a dobutamine infusion. Groups of six ponies were studied. After premedication with acepromazine (0.04 mg/kg) anaesthesia was induced with thiopentone (10 mg/kg) and maintained for 120 min with halothane (group AN). Dobutamine was infused to effect (1.1-4.4 microg/kg/min) to maintain arterial pressure at pre anaesthetic levels. The conscious group (CON) were prepared as for AN and then received only dobutam...
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
Alteration in adrenocortical function in horses with recurrent airway obstruction after aerosol and parenteral administration of beclomethasone dipropionate and dexamethasone, respectively.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 1044-1047 
Rush BR, Worster AA, Flaminio MJ, Matson CJ, Hakala JE.To determine alteration in adrenocortical function in horses with recurrent airway obstruction (heaves) after aerosol and parenteral administration of beclomethasone dipropionate and dexamethasone, respectively. Methods: 6 horses with inducible and reversible heaves. Methods: Episodes of heaves were induced by exposure to moldy hay and straw for 7 days (natural challenge). Horses then underwent treatment (aerosolized beclomethasone, parenterally administered dexamethasone, and aerosolized propellant) for 7 days. Horses remained in the mold-contaminated environment for 7 days after discontinuat...
Endocrine and reproductive consequences of certain endotoxin-mediated diseases in farm mammals: a review.
Acta veterinaria Hungarica    August 15, 1998   Volume 46, Issue 1 71-84 
Jánosi S, Huszenicza G, Kulcsár M, Kóródi P.After giving an overview of the general pathology of endotoxin-mediated diseases, the authors summarise the endotoxin-induced endocrine changes and their clinical consequences, with particular regard to reproduction. The consequences of temporary activation of the cyclooxygenase-2 and lipoxygenase enzyme systems resulting in elevated release of various prostanoids are discussed in cyclic and pregnant ruminants, sows and mares. The clinical failures attributable to increased glucocorticoid secretion as well as the endotoxin-induced changes in thyroid function and in peripheral level of some oth...
Endocrinology of pregnancy: chorionic somatomammotropins and pregnancy-associated glycoproteins: review.
Acta veterinaria Hungarica    August 15, 1998   Volume 46, Issue 2 175-189 
Beckers JF, Zarrouk A, Batalha ES, Garbayo JM, Mester L, Szenci O.The two main groups of placental proteins of ruminants are discussed in this paper: chorionic somatomammotropins (placental lactogens) and pregnancy-specific (-associated) proteins. Placental lactogens belong to the prolactin and growth hormone family. They stimulate mammogenesis, fetal growth and maternal metabolism. Pregnancy-specific proteins and pregnancy-associated glycoproteins belong to the aspartic proteinase family like pepsin, cathepsin D and E. These two groups of proteins are secreted in the maternal circulation by the binucleate cells after their migration to and fusion with the u...
A comparative study of mast cells and eosinophil leukocytes in the mammalian testis.
Zentralblatt fur Veterinarmedizin. Reihe A    August 11, 1998   Volume 45, Issue 4 209-218 doi: 10.1111/j.1439-0442.1998.tb00819.x
Anton F, Morales C, Aguilar R, Bellido C, Aguilar E, Gaytán F.The existence of a physiological integration between the immune and endocrine systems has long been recognized. In spite of the abundant literature data on the presence of cells of the immune system in the testis, mast cells and eosinophil leukocytes have received little attention. We have studied the presence, distribution and numbers of mast cells and eosinophils in the testes of 12 mammalian species. Mast cells were frequently found in equine (stallion, ass and mule) and human testis, whereas eosinophils were nearly absent. On the contrary, eosinophils were abundant in the hare testis, whil...
Triiodothyronine (T3), insulin and characteristics of 5′-monodeiodinase (5′-MD) in mare’s milk from parturition to 21 days post-partum.
Reproduction, nutrition, development    August 11, 1998   Volume 38, Issue 3 235-244 doi: 10.1051/rnd:19980303
Slebodziński AB, Brzezińska-Slebodzińska E, Nowak J, Kowalska K.It is generally accepted that hormones and tissue growth factors are supplied from mother to neonate via mammary secretion. Among the protein hormones, insulin and prolactin are considered as the most important milk components for neonates. The significance of the thyroid hormones, namely triiodothyronine (T3) generated locally by 5'-monodeiodinase (5'-MD) in the mammary tissues, for the mammary gland itself and for suckling neonates is still under consideration. In the present study the activity of the 5'-MD and the concentrations of T3 and insulin in mare's colostrum and milk during the firs...
The effect of social stress on adrenal axis activity in horses: the importance of monitoring corticosteroid-binding globulin capacity.
The Journal of endocrinology    August 6, 1998   Volume 157, Issue 3 425-432 doi: 10.1677/joe.0.1570425
Alexander SL, Irvine CH.Plasma cortisol is largely bound to corticosteroid-binding globulin (CBG), which regulates its bioavailability by restricting exit from capillaries. Levels of CBG may be altered by several factors including stress and this can influence the amount of cortisol reaching cells. This study investigated the effect of social instability on plasma concentrations of CBG, total and free (not protein bound) cortisol in horses. Horses new to our research herd ('newcomers') were confined in a small yard with four dominant resident horses for 3-4 h daily for 3-4 (n = 5) or 9-14 (n = 3) days. Jugular blood ...
[Equine Cushing syndrome (ECS). Case report, review of its diagnosis and therapy and substantial differences from Cushing syndrome in dogs].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    June 17, 1998   Volume 26, Issue 1 41-47 
Fey K, Jonigkeit E, Moritz A.Equine and canine Cushing's syndrome, both of which are the result of elevated cortisol levels, show some different pathogenetical and clinical features and require different therapeutical approaches. In older horses the equine Cushing's syndrome (ECS) is not uncommon. Nearly all cases result from excessive hormone production in cells of the pars intermedia of the pituitary. Besides elevated levels of adrenocorticotrope hormone (ACTH), high peripheral levels of pro-opiomelanocortin, beta-endorphines and alpha-melanocyte-stimulating hormone can be measured. In middle-aged and geriatric dogs, Cu...
Effects of surgery on endocrine and metabolic responses to anaesthesia in horses and ponies.
Research in veterinary science    June 13, 1998   Volume 64, Issue 2 133-140 doi: 10.1016/s0034-5288(98)90008-x
Taylor PM.The effects of surgery on endocrine and metabolic responses to anaesthesia were investigated in seven horses and eight ponies. They were anaesthetised twice and surgery was carried out on one occasion. Cardiorespiratory monitoring was performed and blood samples were taken for assay of cortisol, glucose, lactate, insulin, catecholamines and non-esterified fatty acids. All groups developed arterial hypotension which was more marked in the surgical groups where post operative pulse rate was also higher. Plasma cortisol concentration increased in all groups during anaesthesia but remained higher ...
Effect of exercise on fluid balance and renal function in horses.
The Veterinary clinics of North America. Equine practice    April 30, 1998   Volume 14, Issue 1 23-44 doi: 10.1016/s0749-0739(17)30210-9
McKeever KH.Exercise places large demands on the equine cardiovascular system which are further complicated by environmental factors. In many respects, performance is limited by fluid and electrolyte stores and the ability to maintain cardiovascular and thermoregulatory stability in the face of severe sweat losses. Studies in the exercising horse have been primarily descriptive or associative, with only a limited number seeking to identify physiologic mechanisms associated with the control of fluid and electrolyte balance. More mechanistic studies are needed to fully understand the integration of the card...
Cortisol, peptides and catecholamines in cerebrospinal fluid, pituitary effluent and peripheral blood of ponies.
Equine veterinary journal    April 16, 1998   Volume 30, Issue 2 166-169 doi: 10.1111/j.2042-3306.1998.tb04478.x
Luna SP, Taylor PM.Cannulation of the pituitary effluent in horses is a useful method for investigating the release of pituitary hormones in loco (Irvine and Alexander 1987). Adrenocorticotropic hormone (ACTH) and arginine vasopression (AVP) concentrations in plasma collected from the intercavemous sinus, which receives all the pituitary outflow, were several times greater than those measured in peripheral plasma (Redekopp et at 1986). However, no studies evaluating the pituitary contribution to endogenous opioid secretion have been reported in the equine species. Cerebrospinal fluid (CSF) directly reflects CNS ...
Gonadal and pituitary responsiveness of stallions is not down-regulated by prolonged pulsatile administration of GnRH.
Journal of andrology    April 16, 1998   Volume 19, Issue 1 100-109 
Brinsko SP, Squires EL, Pickett BW, Nett TM.The objective of this study was to determine if prolonged pulsatile administration of homologous gonadotropin-releasing hormone (GnRH) at therapeutic or 5x therapeutic doses would cause down-regulation of the stallion's hypothalamic-pituitary-testicular axis. Fifteen stallions were randomly assigned to three treatment groups (n=5/group) and received a 0.5 ml subcutaneous dose of saline (group 1), 50 microg GnRH (group 2), or 250 microg GnRH (group 3) every 2 hours for 75 days. Weekly evaluations of follicle stimulating hormone, luteinizing hormone, and testosterone and monthly evaluations of d...
Immunocytochemical differences in adenohypophyseal cells among adult Mongolian pony mares, stallions, and geldings.
American journal of veterinary research    April 2, 1998   Volume 59, Issue 3 262-266 
Tan JH, Nanbo Y, Oikawa M, Kiso Y, Sasaki F.To analyze the sex difference in 6 kinds of adenohypophyseal cells of Mongolian ponies and the effect of prepubertal orchidectomy on adenohypophyseal cells. Methods: Pituitary glands collected from 15 adult Mongolian ponies, 5 to 10 years old: 5 stallions, 5 mares, and 5 geldings, orchidectomized between the ages of 1 and 2 years. Methods: Morphologic comparison of 6 kinds of adenohypophyseal cells among mares, stallions, and geldings was done, using immunocytochemistry and morphometry. Results: A sex difference was evident in the percentage of somatotrophs, gonadotrophs (follicle-stimulating ...
Duration of effects of phenylbutazone on serum total thyroxine and free thyroxine concentrations in horses.
Journal of veterinary internal medicine    February 21, 1998   Volume 11, Issue 6 371-374 doi: 10.1111/j.1939-1676.1997.tb00483.x
Ramirez S, Wolfsheimer KJ, Moore RM, Mora F, Bueno AC, Mirza T.The objectives of this study were to determine if phenylbutazone decreased serum thyroxine (TT4) and free thyroxine (FT4) concentrations using radioimmunoassay and equilibrium dialysis techniques in horses, and, if so, an additional objective was to determine the duration of this decreased concentration once phenylbutazone administration was discontinued. Serum TT4 and FT4 concentrations were determined before and after administration of 4.4 mg/kg of phenylbutazone i.v. bid for 5 days. Treatment with phenylbutazone caused a significant decrease in TT4 and FT4 concentrations (P < .05). Serum...
Equine somatotropin (growth hormone)–what therapeutic role?
Veterinary journal (London, England : 1997)    February 10, 1998   Volume 155, Issue 1 3-4 doi: 10.1016/s1090-0233(98)80027-0
Rose RJ.No abstract available
1 21 22 23 24 25 43