Analyze Diet

Topic:Equine Health

Equine health encompasses the study and management of diseases, disorders, and overall well-being of horses. It involves understanding various physiological systems, preventive care, and treatment strategies to maintain optimal health in equine populations. Common areas of focus include nutrition, infectious diseases, orthopedic conditions, and reproductive health. Research in equine health aims to advance knowledge on diagnostic methods, therapeutic interventions, and management practices that improve horse welfare and performance. This page collects peer-reviewed research studies and scholarly articles that explore the diverse aspects of equine health, offering insights into current findings and advancements in the field.
[Equine dental symposium. Veterinarians or assistants?].
Tijdschrift voor diergeneeskunde    September 5, 1998   Volume 123, Issue 16 482-483 
Smeenk G.No abstract available
Mechanical properties of the tendinous equine interosseus muscle are affected by in vivo transducer implantation.
Journal of biomechanics    September 4, 1998   Volume 31, Issue 5 485-490 doi: 10.1016/s0021-9290(98)00023-2
Jansen MO, Schamhardt HC, van den Bogert AJ, Hartman W.Liquid metal strain gauges (LMSGs) were implanted in the tendinous interosseous muscle, also called suspensory ligament (SL), in the forelimbs of 6 ponies in order to quantify in vivo strains and forces. Kinematics and ground reaction forces were recorded simultaneously with LMSG signals at the walk and the trot prior to implantation, and 3 and 4 days thereafter. The ponies were euthanised and tensile and failure tests were performed on the instrumented tendons and on the tendons of the contra lateral limb, which were instrumented post mortem. The origo-insertional (OI) strain of the SL was co...
A model equation for the prediction of mechanical internal work of terrestrial locomotion.
Journal of biomechanics    September 4, 1998   Volume 31, Issue 5 463-468 doi: 10.1016/s0021-9290(98)00038-4
Minetti AE.By refining a previously published model, a simple equation for the estimation of the mechanical internal work during locomotion is presented. The only input variables are the progression speed, the stride frequency and the duty factor, i.e. the fraction of the stride duration at which a foot is in contact with the ground. The inclusion of this last variable, easily measurable, allows to obtain a single equation for both walking and running. The model predictions have been compared with the mechanical internal work experimentally obtained on humans in several conditions: speeds (range 0.8-3.3 ...
Evidence that commercial calf and horse sera can contain substantial amounts of trans-10,cis-12 conjugated linoleic acid.
Lipids    September 4, 1998   Volume 33, Issue 8 817-819 doi: 10.1007/s11745-998-0275-x
Park Y, Pariza MW.We analyzed fetal calf, newborn calf, horse, and adult cow sera for conjugated linoleic acid (CLA). All sera samples contained CLA, but the amounts varied. The predominant isomer was cis-9,trans-11 CLA but some samples appeared to contain substantial amounts of an isomer with the retention time of trans-10,cis-12 CLA.
Use of antimicrobial drugs in veterinary practice.
BMJ (Clinical research ed.)    September 4, 1998   Volume 317, Issue 7159 665-667 doi: 10.1136/bmj.317.7159.665
Johnston AM.No abstract available
Neutralizing potency of horse antibothropic antivenom. Correlation between in vivo and in vitro methods.
Toxicon : official journal of the International Society on Toxinology    September 2, 1998   Volume 36, Issue 10 1433-1439 doi: 10.1016/s0041-0101(98)00077-4
Maria WS, Cambuy MO, Costa JO, Velarde DT, Chávez-Olórtegui C.The correlation coefficients between in vivo neutralization of lethal toxicity (ED50), neutralization of the hemolytic activity (PLA2) and levels of antibodies measured by ELISA, was investigated to test the potency of horse anti-bothropic antivenom. Twenty six horses were hyperimmunized with Bothrops venoms (B. alternatus, B. jararaca, B. jararacussu, B. neuwiedii and B. moojeni). To set up an indirect ELISA, for neutralization of PLA2 activity and for determination of ED50 in Swiss mice, the whole Bothrops jararaca venom (reference venom for assessing the bothropic antivenom potency in Brazi...
Development of an ELISA to assess the potency of horse therapeutic polyvalent antibothropic antivenom.
Toxicon : official journal of the International Society on Toxinology    September 2, 1998   Volume 36, Issue 10 1363-1370 doi: 10.1016/s0041-0101(98)00014-2
Heneine LG, Carvalho AD, Barbosa CF, Arávjo dos Santos MR.The objective of this study was the search for a suitable venom antigen to be used in an in vitro alternative immunoassay, to the standard antivenom neutralization assay using mice. Bothrops jararaca venom was fractionated in DEAE-Sephacel columns and the fractions were tested for a correlation between antibody capture enzyme linked immunosorbent assay (ELISA) absorbance values and the 'in vivo' antivenom potency. Individual antivenoms from 14 horses and 15 separate FUNED polyspecific Bothrops ampouled antivenoms (final product) were used. Fractions showing the higher correlations were further...
The Feasibility and Benefits of TPN in Horses: A Review of the Findings.
International journal of pharmaceutical compounding    September 1, 1998   Volume 2, Issue 5 351-353 
Paoletti J, Downing D, Tormo VJ.No abstract available
Modifications of the form and amplitude of the electrocardiographic QRS complex during growth in the Spanish-bred Horse.
Zentralblatt fur Veterinarmedizin. Reihe A    August 28, 1998   Volume 45, Issue 5 309-317 doi: 10.1111/j.1439-0442.1998.tb00833.x
Ayala I, Montes A, Benedito JL, Castillo C, Hernández J, Gutierrez C, García-Partida P.Configuration and amplitude values of the QRS complex of the electrocardiogram were studied with standard Einthoven leads in 173 healthy Spanish-bred (Andalusian) horses, aged between 1 month and 17 years. Animals which were 1 month old had a predominantly negative QRS complex, whereas a predominantly positive complex direction was found in the rest of the animals. Statistically significant variations were found for the Q-wave and QRS main vector between the different age groups, with highest values for the Q-wave and most negative values for the direction of the QRS main vector in animals up ...
Selected blood parameters during recovery from strenuous running exertion in trotters.
Zentralblatt fur Veterinarmedizin. Reihe A    August 28, 1998   Volume 45, Issue 5 279-286 doi: 10.1111/j.1439-0442.1998.tb00828.x
Pinkowski W, Mohr E, Krzywanek H.During training, in 10 trotters, blood samples from the vena jugularis were taken before and after a heat with 80% of maximum capability as well as in the recovery period. Lactic acid concentration and pH-value, haematocrit and haemoglobin content, as well as protein concentration and osmolality were measured. With the exception of protein concentration, the time course of the values during the recovery could be described by simple mathematical models (biexponential or exponential equations). Only in the case of blood lactate concentration, the basal value was not yet achieved 120 min after th...
An outbreak of equine leukoencephalomalacia at Oaxaca, Mexico, associated with fumonisin B1.
Zentralblatt fur Veterinarmedizin. Reihe A    August 28, 1998   Volume 45, Issue 5 299-302 doi: 10.1111/j.1439-0442.1998.tb00831.x
Rosiles MR, Bautista J, Fuentes VO, Ross F.Equine leukoencephalomalacia (ELEM), swine pulmonary oedema and human oesophageal cancer have been associated with fumonisine B1 (FB1) ingestion. For the first time in this study it is reported that FB1 was identified as being associated with an outbreak of ELEM at Oaxaca, Mexico. Symptoms of ELEM and Equine Venezuelan Encephalitis (EVE) are similar and a different diagnosis is obligatory. In the geographical area (Oaxaca, Mexico) where donkeys died showing a neurological syndrome, 14 corn samples were collected. With the use of TLC (Thin layer chromatography) and HPLC (High performance liquid...
Effect of density and weight of load on the energy cost of carrying loads by donkeys and ponies.
Tropical animal health and production    August 28, 1998   Volume 30, Issue 1 67-78 doi: 10.1023/a:1005021729061
Pearson RA, Dijkman JT, Krecek RC, Wright P.Two experiments were designed to compare the energy used in carrying loads by donkeys and ponies. In the first experiment 3 donkeys and 3 ponies were compared on treadmills in the UK. Density of load (lead shot or straw) had no significant effect on the energy cost of carrying loads; however, the energy cost of carrying a load decreased significantly (p < 0.001) as the weight of the load increased (in donkeys 6.44, 4.35 and 3.03 J/kg load/m, in ponies 5.82, 3.75 and 3.68 J/kg load/m, for loads of 13, 20 and 27 kg/100 kg liveweight (M) respectively). Differences between species were not sign...
Six new cosmid derived and physically mapped equine dinucleotide repeat microsatellites.
Animal genetics    August 28, 1998   Volume 29, Issue 3 236-238 doi: 10.1046/j.1365-2052.1998.00236.x
Marti E, Breen M, Fischer P, Swinburne J, Binns MM.No abstract available
Renal failure, laminitis, and colitis following severe rhabdomyolysis in a draft horse-cross with polysaccharide storage myopathy.
The Canadian veterinary journal = La revue veterinaire canadienne    August 26, 1998   Volume 39, Issue 8 500-503 
Sprayberry KA, Madigan J, LeCouteur RA, Valentine BA.A Thoroughbred-Percheron crossbred gelding developed a fulminant cascade of sequelae following a severe episode of rhabdomyolysis. Complications may occur with rhabdomyolysis of any etiology. In warmblood horses with Percheron bloodlines, rhabdomyolysis may be secondary to polysaccharide storage disease, and aggressive therapy should be undertaken promptly to avoid the complications.
Progesterone determination in equine plasma using different immunoassays.
Acta veterinaria Hungarica    August 26, 1998   Volume 46, Issue 4 501-513 
Nagy P, Solti L, Kulcsár M, Reiczigel J, Huszenicza G, Abaváry K, Wölfling A.Several assay systems (3H radioimmunoassay (RIA) with and without extraction; microplate enzyme-linked immunoassay (ELISA); qualitative ELISA (tube test)] were used to measure plasma progesterone concentration in mare plasma. The direct RIA showed a close correlation (R = 0.94) with the extraction RIA. The direct RIA and the microplate ELISA were compared in two different studies. In the first study 1155 samples of postpartum mares were used for progesterone determination with both assays. The ELISA resulted in more elevated values both in oestrus and dioestrus (0.19+/-0.3 and 2.44+/-3.62 nmol...
Associations between physical examination, laboratory, and radiographic findings and outcome and subsequent racing performance of foals with Rhodococcus equi infection: 115 cases (1984-1992).
Journal of the American Veterinary Medical Association    August 26, 1998   Volume 213, Issue 4 510-515 
Ainsworth DM, Eicker SW, Yeagar AE, Sweeney CR, Viel L, Tesarowski D, Lavoie JP, Hoffman A, Paradis MR, Reed SM, Erb HN, Davidow E, Nalevanko M.To determine whether physical examination, laboratory, or radiographic abnormalities in foals with Rhodococcus equi infection were associated with survival, ability to race at least once after recovery, or, for foals that survived and went on to race, subsequent racing performance. Methods: Retrospective study. Methods: 49 Thoroughbreds and 66 Standardbreds admitted to 1 of 6 veterinary teaching hospitals between 1984 and 1992 in which R equi infection was positively diagnosed. Methods: Results of physical examination, laboratory testing, and thoracic radiography were reviewed. Indices of raci...
Effect of synovitis and corticosteroids on transcription of cartilage matrix proteins.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 1021-1026 
MacLeod JN, Fubini SL, Gu DN, Tetreault JW, Todhunter RJ.To determine whether steady-state levels of type-II procollagen, aggrecan core protein, or fibronectin mRNA in articular chondrocytes are altered by synovitis or administration of methylprednisolone acetate (MPA). Methods: Articular cartilage specimens collected from 10 ponies, 2.5 to 3.5 years old and 200 to 300 kg. Methods: 4 experimental groups were compared, using the cartilage specimens: control, MPA-treated, lipopolysaccharide-induced synovitis, and lipopolysaccharide-induced synovitis with MPA treatment. RNA was isolated from articular cartilage and compared by northern blot analysis, u...
[Percutaneous occlusion of arterial vessels using permanent embolization for the treatment of an air sac hemorrhage in horses. A case report].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    August 26, 1998   Volume 26, Issue 4 211-215 
Schneider M, Fey K, Tellhelm B, Litzke LF, Sasse HH.This article reports a case of guttural pouch bleeding which was managed successfully by using intravascular embolisation systems to occlude the damaged vessels. Percutaneous catheterisation of the common carotid artery allowed angiographic visualisation of the main head arteries: A. carotis externa, A. carotis interna and A. occipitalis, which showed no abnormalities angiographically. Originating from the A. occipitalis, one artery sent smaller, extensively branching and tortuous vessels to the guttural pouch area. This branching was interpreted as a sign of inflammatory hypervascularization....
Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.
European journal of biochemistry    August 26, 1998   Volume 255, Issue 2 432-438 doi: 10.1046/j.1432-1327.1998.2550432.x
Johnsen AH, Sandin A, Rourke IJ, Bundgaard JR, Nilsson G, Rehfeld JF.Previous studies have indicated that equine G-cell processing of progastrin differs from that of other species. Since the difference may be due to structural features, we have identified equine gastrin-17 and -34 (<ELGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF-NH2), and cloned a corresponding 451-bp cDNA that encodes a 107-amino-acid preprogastrin. Comparison with other mammalian gastrins shows a high degree of conservation, but instead of four or five acidic residues preceding the bioactive carboxyamidated C-terminal heptapeptide, equine gastrin contains the remarkable substitution of Lys for Glu in ...
[The clinical case. Warmblood foal, male, eight weeks old].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    August 26, 1998   Volume 26, Issue 4 210-217 
Sinsbeck H, Becker M, Dumke S.No abstract available
Babesia equi field isolates cultured from horse blood using a microcentrifuge method.
The Journal of parasitology    August 26, 1998   Volume 84, Issue 4 696-699 
Holman PJ, Becu T, Bakos E, Polledo G, Cruz D, Wagner GG.Babesia equi, a causative agent of equine piroplasmosis, was isolated from horses in the Chaco Province of Argentina, a known piroplasmosis endemic region. Fifteen B. equi field isolates were acquired by culture from 23 actively working horses from 2 ranches. The horses appeared healthy with no clinical signs or histories indicative of equine piroplasmosis. All 23 horses had B. equi-specific antibody activity by the indirect fluorescent antibody test and 18 were also complement fixation test positive for B. equi. Equine erythrocytes were prepared for parasite culture using a microcentrifuge tu...
Temporal effects of an infusion of dobutamine hydrochloride in horses anesthetized with halothane.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 1027-1032 
Young LE, Blissitt KJ, Clutton RE, Molony V.To evaluate temporal hemodynamic effects of dobutamine in horses anesthetized with halothane. Methods: 8 adult Thoroughbreds. Methods: Anesthesia was induced by i.v. administration of romifidine and ketamine and maintained using halothane in oxygen. After 60 minutes, dobutamine was administered i.v. for 60 minutes at 4 micrograms/kg of body weight/min. Measurements of left ventricular function were obtained by transesophageal echocardiography and cardiac catheterization. Results: Mean, systolic, diastolic, aortic, pulmonary arterial, and left and right ventricular end-diastolic and systolic pr...
Transfer of a uterine lipocalin from the endometrium of the mare to the developing equine conceptus.
Biology of reproduction    August 26, 1998   Volume 59, Issue 3 483-490 doi: 10.1095/biolreprod59.3.483
Crossett B, Suire S, Herrler A, Allen WR, Stewart F.One of the major, progesterone-dependent proteins secreted into the uterine lumen of the mare is a 19-kDa lipocalin (P19). It associates strongly with the embryonic capsule that envelops the young horse conceptus in early gestation, suggesting that it may be involved in sustaining early development. However, it was not known whether the protein was transported through the capsule and/or trophoblast layer and into the yolk sac cavity. To address this question, polyclonal antisera were raised against a C-terminal peptide (based on the deduced amino acid sequence of P19) and a recombinant-derived...
Complications associated with administration of detomidine into the caudal epidural space in a horse.
Journal of the American Veterinary Medical Association    August 26, 1998   Volume 213, Issue 4 516-518 
Wittern C, Hendrickson DA, Trumble T, Wagner A.A 364-kg (800-lb) 15-month-old sexually intact cryptorchid male Quarter Horse was admitted to the veterinary teaching hospital for castration. The horse was placed in standing stocks, and a caudal epidural injection of 18 mg of detomidine hydrochloride (50 micrograms/kg [23 micrograms/lb] of body weight) was administered. Fifteen minutes after injection, the horse unexpectedly collapsed to the floor, first into sternal, and then into lateral, recumbency. Because the horse would not get up, the decision was made to perform the surgery with the horse under general anesthesia. The horse required ...
Experimental model of synovitis/capsulitis in the equine metacarpophalangeal joint.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 978-985 
Cornelissen BP, Rijkenhuizen AB, van den Hoogen BM, Rutten VP, Barneveld A.To develop and define a model of acute synovitis/capsulitis in the equine metacarpophalangeal joint (fetlock) to study clinical effects of diagnostic or therapeutic procedures. Methods: 5 adult Standardbreds. Methods: Polyvinyl alcohol foam particles were injected into the left front fetlock of horses; the right front fetlock was used as a control. Horses were examined clinically and for lameness on a regular basis. Blood samples were taken to measure routine variables. Synovial fluid samples were collected from both fetlocks, and macroscopic, microscopic, and biochemical variables were measur...
Use of metronidazole in horses.
The Veterinary record    August 26, 1998   Volume 143, Issue 3 87 
Nind F, Taylor PM.No abstract available
Functional anatomy of the cartilage of the distal phalanx and digital cushion in the equine foot and a hemodynamic flow hypothesis of energy dissipation.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 961-968 
Bowker RM, Van Wulfen KK, Springer SE, Linder KE.To examine macro- and microscopic characteristics of cartilage of the distal phalanx (ungual cartilage [UC]) and digital cushion in the equine foot and to relate them to the foot's function of energy dissipation. Methods: 85 horses and 5 foals of various breeds and ages. Methods: Feet, obtained at necropsy, were perfused with India ink (n = 30), latex (5), or polymer plastic (10). Select feet were examined histologically for tissue architecture and to identify elastic fibers. Immunochemistry to identify substance P peptides in nerves (feet from foals) and gold chloride impregnation of axons (n...
[Fundamentals of hygiene to be used for stallions in an instrumental artificial insemination].
Tierarztliche Praxis. Ausgabe G, Grosstiere/Nutztiere    August 26, 1998   Volume 26, Issue 4 218-224 
Klug E, Sieme H, Peters E.Equine artificial insemination (AI) meanwhile has been widely established in the warm blood horse industry. Because of its importance consistent hygienic aspects and their significance for the use of stallions as semen donors in AI-programs are presented and clarified. Incidence as well as importance of equine venereal infectious diseases are considered. Data of physiological bacterial genital flora and treatment principles of therapeutic control of venereal infectious bacterial agents as well as a model of control of Equine Viral Arteritis are given. A prophylactic hygiene program for donor s...
Mechanical correlations derived from segmental histologic study of the equine superficial digital flexor tendon, from foal to adult.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 969-977 
Crevier-Denoix N, Collobert C, Sanaa M, Bernard N, Joly C, Pourcelot P, Geiger D, Bortolussi C, Bousseau B, Denoix JM.To assess histologic variations of the equine superficial digital flexor tendon (SDFT) according to site and to horse age and activity, and to correlate these data with reported segmental mechanical results. Methods: Superficial digital flexor tendons isolated from 42 horses 0.5 hour to 23 years old. Methods: 7 segments of each SDFT were delimited and submitted for conventional histologic examination. Each segment was examined and graded for fiber undulation, cellularity, number and size of interfascicular connective spaces (ICS), presence or absence of focal and diffuse chondroid metaplasia, ...
Alteration in adrenocortical function in horses with recurrent airway obstruction after aerosol and parenteral administration of beclomethasone dipropionate and dexamethasone, respectively.
American journal of veterinary research    August 26, 1998   Volume 59, Issue 8 1044-1047 
Rush BR, Worster AA, Flaminio MJ, Matson CJ, Hakala JE.To determine alteration in adrenocortical function in horses with recurrent airway obstruction (heaves) after aerosol and parenteral administration of beclomethasone dipropionate and dexamethasone, respectively. Methods: 6 horses with inducible and reversible heaves. Methods: Episodes of heaves were induced by exposure to moldy hay and straw for 7 days (natural challenge). Horses then underwent treatment (aerosolized beclomethasone, parenterally administered dexamethasone, and aerosolized propellant) for 7 days. Horses remained in the mold-contaminated environment for 7 days after discontinuat...